SecReT6
Protein ID: 310819088
SecReT6 ID500
T6SS typei1
Gene symbol-
Locus tagSTAUR_1815
StrainStigmatella aurantiaca DW4/3-1
Repliconchromosome [GenBank: NC_014623] [Browse all T6SS(s) in this replicon]
Location [Strand]2246576..2250430 [+]
Producthypothetical protein
NoteTssM
UniProt IDE3FTK5
KEGG IDsur:STAUR_1815
PDB IDNA
Domain hit(s) vs Pfam DUF1215 [PF06744], Evalue: 7.30E-19, Aligned region: 265..280
DUF1215 [PF06744], Evalue: 7.30E-19, Aligned region: 1022..1138
ImcF-related_N [PF14331], Evalue: 0.00045, Aligned region: 210..279
Protein Sequence: 1284 a.a.     [Download]
>gi|310819088|ref|YP_003951446.1| hypothetical protein STAUR_1815 [Stigmatella aurantiaca DW4/3-1]
MGPQLLNGVGQALNVADPTKALEAAGKVLDAGAPPPEGASAPASEGFWLTVAPYLKWALIALLVALLVAL
LVFAGVKLYQWWRRRRSASAASSGPPPMASNRLLQVHRAFLSGLPLANRAAVLDLPTVVVLGPAGSGKTL
LIGLDVDWQRQARQFLPSHTSDSLLQVYLGPDCVVQELSAPLLEDETLQARSALRRMWSKCFNRRQGGLA
VLTLDIRWLAETPPDEQRRMAQLLRGKLNLISEACGGPVETRLCLTHMDGLEGFEDFARLLRQHGVARSF
EIPKQGEESRLSTLLEGQEQYLALGLTSLPVDAFERLERFYSQGGRSFAALGRFVSSLLEGDTLSFKPRL
TRVYLSSPTPEARASGTLSVMSEEGSTLAPRSLYLRTHQRRAALIALVGCLPVLAAYANFYMLLGDAQEQ
VARFESTVAQMQEQGLEGRGEVVEEQVNEAADAISHLWSAARWWPPLNSSFPGEMLDVRQRLARGIRESH
LRPTLEHCRKHPQDCRPEQVVYLLAALHASNKNGLGNFVNSSIQPRHSRRWTGNQAGASKTAEVAASEQS
RTWITALELREPLVATYVLASDEPWERNPPCRRGAAQVAHSAETEWSCWPYAERLTVESQLKPWLDHLLF
LRQALEAGPKGLAQLDQRREERERLEAQLADLDVYASLPTVLNLIDTAGIQSNTRHFQGIESTVQVLDWL
RTNRDTLATVLDMEEEAYSGLLAVEKMGPSELLTRDGLWLTGTKKGPYRIELLQQSFEFRPPQLSRELLQ
ALLDAYEKSGRLTMGPNEAIRPGQLILSRTPFETDLKPLVDDFTQRLKNVQLPTDESAKREEYVQKRVGV
FAQGYREGLFHSVRNYRFVAPRKALFDELARLTQPSSEQVDMLRDVALRASLDPLEGPYYEPLRNAVAPF
RPIVQLMVTDKSGFYAALAPYHALIAQMHDELDAGARRGQSKGGKAAGEAPDKGKEAQAAGADAPAAGAG
GEAGSAELVDMLTPLERVALSMLLEEEGSYLRKAQEWLDQQGISGELRQPFLEPFLQVQRLGKQELESTL
SRQWEEASGRMLRSMLERYPFNPTSPQDVDPGELEVLRRKDGAFWSFVNQMFSRVCVERGTQWSLRGPLR
EKLVLPEQMLLTLSRLSRLATLLWDEEGRSRPLMLKVQPQPLPTPPIPGVFVTMSSLKCGKTTAYGFNQI
PTWQDFPVNWWDQQVSSIVLELRSPARDAPQYVSLPWNRSAWSCFRLFEEAVLTTDQRRQWSLALQGNAG
DKRGLEISFGLKGEPWVPFREVPR
 
Nucleotide Sequence: 3855 bp     [Download]
>gi|310817278|ref|NC_014623.1|:2246576-2250430 Stigmatella aurantiaca DW4/3-1 chromosome, complete genome
GTGGGGCCGCAGCTGCTGAACGGGGTGGGACAGGCGCTGAACGTGGCGGATCCAACCAAGGCGCTTGAGG
CGGCCGGGAAGGTGCTCGACGCGGGGGCCCCGCCGCCGGAAGGCGCGAGCGCACCGGCGTCCGAGGGGTT
CTGGCTCACGGTGGCCCCCTACCTGAAATGGGCGTTGATCGCGCTCCTCGTGGCGCTCCTCGTGGCGCTC
CTCGTGTTCGCCGGGGTGAAGCTCTATCAGTGGTGGCGCCGCCGCCGCTCGGCTTCGGCCGCATCCAGCG
GTCCTCCCCCCATGGCGTCCAACCGCCTGCTCCAGGTGCACCGGGCTTTTCTCTCCGGGTTGCCCCTGGC
CAACCGGGCCGCCGTGCTGGATTTGCCCACCGTGGTGGTGCTCGGCCCCGCGGGCAGCGGCAAGACGCTG
CTCATTGGCCTGGATGTCGATTGGCAGCGCCAGGCCCGGCAATTCCTCCCCAGCCACACGTCGGACTCGC
TGTTGCAGGTGTACCTGGGCCCAGACTGCGTGGTGCAGGAGCTCTCGGCCCCGCTGTTGGAAGATGAGAC
GCTTCAAGCCCGCAGCGCTTTGCGCCGGATGTGGAGCAAGTGTTTCAACCGCCGCCAGGGGGGGCTGGCC
GTCCTCACGCTGGACATCCGCTGGCTCGCGGAGACCCCGCCGGATGAGCAGCGGCGCATGGCGCAGCTCC
TGCGTGGCAAGCTGAACCTCATCTCCGAGGCCTGTGGGGGGCCGGTGGAGACGCGCCTGTGTCTGACCCA
CATGGATGGGTTGGAGGGCTTCGAGGATTTCGCCCGGCTGCTGAGGCAGCATGGTGTGGCGAGATCCTTC
GAGATTCCCAAGCAGGGTGAAGAGTCCCGTCTGTCCACGCTGCTGGAAGGGCAGGAGCAGTACCTGGCCC
TGGGGCTCACCTCGTTGCCGGTCGATGCCTTCGAGCGCCTGGAGCGCTTCTATTCGCAGGGAGGCCGCTC
GTTCGCGGCGCTGGGCCGGTTCGTCTCCTCGTTGCTGGAGGGCGATACCCTCTCGTTCAAGCCGCGCCTC
ACGCGCGTCTACCTGTCCTCTCCCACGCCCGAGGCGCGCGCCAGCGGCACACTGTCGGTCATGTCCGAGG
AGGGCAGCACCCTGGCGCCGCGCAGCCTCTACCTGCGCACCCACCAGCGCCGCGCCGCGTTGATTGCGCT
GGTGGGCTGTCTGCCGGTGCTGGCCGCGTATGCGAACTTCTACATGCTGCTGGGCGATGCGCAGGAGCAG
GTGGCGCGCTTCGAGAGCACGGTCGCGCAGATGCAGGAGCAGGGGCTGGAGGGGCGGGGAGAGGTCGTCG
AGGAGCAGGTGAACGAGGCGGCGGATGCCATCAGCCACTTGTGGAGCGCGGCCCGCTGGTGGCCGCCCCT
GAACTCCAGCTTCCCAGGAGAGATGCTGGATGTGCGCCAGCGGCTGGCCCGGGGCATCCGGGAGAGCCAC
CTGCGGCCCACCCTCGAGCACTGCCGCAAGCACCCCCAGGACTGCCGCCCCGAGCAGGTGGTCTACCTGC
TGGCCGCCCTCCACGCGTCGAACAAGAATGGGCTCGGCAACTTCGTGAACTCCAGCATTCAGCCTCGGCA
CTCGCGGAGGTGGACCGGCAATCAGGCCGGTGCCTCCAAGACGGCGGAGGTGGCTGCCTCCGAGCAGAGC
CGTACCTGGATCACCGCGCTGGAATTGCGCGAGCCGCTCGTGGCGACCTACGTGCTGGCCAGCGACGAGC
CCTGGGAGCGCAATCCCCCGTGCCGCCGGGGGGCCGCGCAGGTGGCTCATAGCGCGGAGACCGAGTGGTC
CTGCTGGCCCTATGCGGAGCGGCTGACGGTCGAGAGTCAGCTCAAGCCCTGGTTGGATCACCTGCTGTTC
CTCCGCCAAGCGCTGGAGGCGGGCCCCAAGGGGCTGGCCCAACTGGATCAGCGGCGGGAAGAGCGGGAGC
GGCTGGAGGCACAGCTGGCGGATCTCGATGTCTATGCCTCGCTGCCCACGGTGCTCAACTTGATTGACAC
CGCGGGAATCCAATCCAACACGCGTCACTTCCAGGGCATCGAGTCCACGGTTCAGGTGCTCGATTGGTTG
CGGACGAACCGGGACACCCTCGCCACGGTGTTGGACATGGAGGAAGAGGCCTACTCGGGCCTCCTGGCCG
TGGAGAAGATGGGCCCCTCCGAGTTGCTCACCCGGGATGGGCTCTGGCTGACGGGCACCAAGAAGGGGCC
GTACCGGATCGAGCTGTTGCAGCAGTCTTTCGAGTTCCGTCCTCCCCAGCTGTCGCGGGAACTCTTGCAA
GCCCTGCTCGATGCCTACGAGAAGAGCGGCCGGTTGACCATGGGGCCCAACGAGGCCATCCGCCCAGGGC
AGTTGATCCTGAGCCGGACGCCCTTCGAGACCGATCTCAAGCCGCTCGTGGATGACTTCACCCAGCGGTT
GAAGAACGTCCAGCTGCCGACCGACGAGTCCGCCAAGCGCGAGGAGTATGTGCAGAAGCGGGTGGGCGTG
TTCGCCCAGGGCTACCGCGAGGGGCTCTTCCACAGCGTTCGCAACTACCGTTTCGTCGCGCCGCGCAAGG
CGCTGTTCGACGAGCTGGCGCGGCTCACCCAACCCTCGTCCGAGCAGGTGGACATGCTGCGCGACGTGGC
CCTCCGGGCCAGTCTGGATCCGCTGGAGGGGCCCTACTACGAGCCGCTGCGCAACGCGGTGGCCCCCTTC
CGGCCCATCGTCCAGCTCATGGTCACCGACAAGAGCGGCTTCTATGCCGCGCTGGCCCCGTACCACGCCT
TGATTGCCCAGATGCACGATGAGCTGGACGCGGGGGCCAGGCGCGGCCAGTCCAAGGGGGGCAAGGCCGC
GGGGGAGGCTCCGGACAAGGGCAAAGAGGCTCAGGCGGCTGGAGCAGACGCCCCTGCCGCAGGCGCTGGA
GGCGAAGCGGGGTCCGCGGAACTCGTGGACATGCTCACGCCGCTGGAGCGGGTGGCGCTCTCGATGCTCC
TCGAGGAGGAGGGCTCCTACCTGCGCAAGGCGCAGGAGTGGCTGGATCAGCAGGGCATCTCGGGAGAGTT
GCGGCAGCCTTTTCTCGAACCCTTCTTGCAGGTGCAGCGCCTGGGCAAGCAAGAGCTGGAGAGCACCCTG
TCGCGGCAGTGGGAGGAGGCCTCCGGACGCATGCTGCGCTCCATGTTGGAGCGTTATCCTTTCAACCCCA
CCTCTCCGCAGGACGTGGATCCCGGCGAACTGGAGGTGCTGCGCCGCAAGGATGGCGCCTTCTGGAGCTT
CGTGAACCAGATGTTCTCCCGGGTGTGCGTGGAGCGCGGAACCCAGTGGTCTCTGCGAGGGCCCTTGCGC
GAGAAGCTGGTGCTGCCCGAGCAGATGCTGCTGACGCTCAGCCGGTTGTCCCGGCTGGCGACGCTGTTGT
GGGACGAGGAGGGCCGCTCCCGGCCGTTGATGTTGAAGGTGCAGCCCCAGCCTCTGCCCACGCCGCCGAT
CCCAGGCGTCTTCGTCACCATGTCCTCGCTCAAGTGCGGGAAGACGACCGCCTACGGCTTCAATCAGATT
CCCACCTGGCAGGATTTCCCCGTGAACTGGTGGGATCAGCAGGTATCCTCGATTGTCCTGGAGCTGCGCT
CCCCCGCGCGGGATGCCCCCCAGTACGTGTCCTTGCCCTGGAATCGCTCGGCCTGGAGCTGCTTCCGCTT
GTTCGAGGAGGCGGTGCTCACCACGGACCAGCGCCGTCAGTGGAGCCTTGCATTGCAGGGGAATGCCGGA
GACAAACGCGGGCTGGAGATCAGCTTTGGGCTCAAGGGTGAGCCCTGGGTTCCTTTCCGGGAGGTGCCGC
GGTGA
 Primer design