SecReT6
Protein ID: 311108873
SecReT6 ID412
T6SS typei4b
Gene symbol-
Locus tagAXYL_05712
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6138702..6142502 [+]
Producthypothetical protein
NoteTssM
UniProt IDE3HGA8
KEGG IDaxy:AXYL_05712
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.20E-73, Aligned region: 100..119
ImcF-related_N [PF14331], Evalue: 3.20E-73, Aligned region: 200..460
IcmF-related [PF06761], Evalue: 2.30E-52, Aligned region: 81..115
IcmF-related [PF06761], Evalue: 2.30E-52, Aligned region: 505..852
DUF1215 [PF06744], Evalue: 6.80E-29, Aligned region: 803..825
DUF1215 [PF06744], Evalue: 6.80E-29, Aligned region: 979..1097
Protein Sequence: 1266 a.a.     [Download]
>gi|311108873|ref|YP_003981726.1| hypothetical protein AXYL_05712 [Achromobacter xylosoxidans A8]
MRSPSDLLSGTSRAISEGRHWSSRALANPRTFMALGLLALVVFLFLFADTVEIGLAWAGIALGVCVLLWL
CAYLWRRRRTRKANKNLGDMLEQQVQTGAAANRNDVEALRTRLTQAVRTIKTSKIGQTSGNEALYELPWY
IVIGNPAAGKSSAVINSGLQFPFADKNGAAVRGVGGTRNCDWFFTTEGILLDTAGRYSVHEEDRNEWMGF
LDLLKRHRPKAPINGIIVAASIDELTGAGPEFAINLAKNLRQRVQELTDRLEVFAPVYIIFTKADLISGF
SEFFSDSDQSERDRVWGATLPYGAEENRDVLALFDSRFDELYEGLKEMGTAQISLRNSRDLPPGLLTFPL
EFAGIKPALRTFLSTLFETNPFQYKPVFRGFYFTSALQEGVTQSTSTERLAERFELRPAQRAQTRSVTSN
NGFFLRDLFSSVIFADKKLVRQHASPAKTRMRYLAFFGLVLALGLVLGGWSWSYLGNRQLAQNVQADLDK
VVRLQSERTDLQSRLEAMEILQDRIEQLDRYSSSRPWSLGLGLYQGDVLKERLLAEYYNGARQFMLAPVK
TSLEDFLAKVDTSATAASGGAPQPAPQQARAAHAAGGDTLFQDASPTNADDAYNALKTYLMMANHQHVDP
THLSDQITRFWRGWLETNRGAMPRDQLIRSAERLISFYVGRAQDEGWPQIDTNLALVEKTRGSLRAVMQG
MPARERAYATLKARAATRFQAMTVARIVGENDAGVVAGSYAIPGTFTREAWEQYIQPAIGEAAKKEVQTS
DWVLGVNARDDLTLEGSPEQIQKSLATMYKTEYAEEWQKFLRGVTIKPFTSFEQSVGAMNRLGDPQTSPI
AKLINTTYEQTSWDNPSLINAGLQQAQSGVVGWFKRVILRQTPPSAAPATAANGEAIPMGPVGREFSDVA
RLVVTRDNQSLLGNYMGALSKIRTRFNLLNNQGDPGPGALTLMRQTLEGKDSELADALKLVDEQMLAGMS
ATQRETLRPLLVRPLIQAYAVTMQPAESELNKVWNAQIYRPFNQTLAEKYPFASRASVEASSDEIGQVFG
PQGSIAKYVNDTLGPLTVRRGDILTARTWGDMGVSLQPTFTANFAQWVAPLSGGAAGSGAASQPQTLFQI
QPKPAAGVTEYTIEIDGQQLRYRNTPPQWVNFVWPNAQGAPGARITATTFDGSVVEIVNEPGRFGLERLI
ATAQRTANADGSFNMSWGKSNVTVPVKLRIISNAQAPGAGGSEPGGSQGLRNLRLPSSVVGASPESSAQT
QPGAPQ
 
Nucleotide Sequence: 3801 bp     [Download]
>ref|NC_014640.1|:6138702-6142502 hypothetical protein AXYL_05712 [Achromobacter xylosoxidans A8]
ATGCGCAGCCCCTCCGATCTTCTATCCGGCACCTCCCGCGCCATCAGCGAAGGCCGCCATTGGTCTTCGC
GCGCGCTGGCCAATCCGCGCACCTTCATGGCGCTGGGACTGCTGGCCCTGGTGGTATTCCTGTTCCTGTT
CGCCGACACGGTAGAGATCGGCCTGGCCTGGGCCGGCATCGCCCTGGGCGTATGCGTGCTGCTGTGGCTG
TGCGCCTATCTGTGGCGCCGGCGGCGCACCCGCAAGGCCAACAAGAACCTGGGCGACATGCTGGAACAGC
AGGTGCAGACCGGCGCGGCCGCCAACCGCAACGACGTGGAAGCGCTGCGCACGCGGCTGACGCAGGCGGT
GCGCACCATCAAGACCTCGAAGATCGGCCAGACCTCTGGCAACGAAGCCCTGTACGAACTGCCCTGGTAC
ATCGTCATCGGCAACCCAGCCGCGGGCAAGAGCAGCGCCGTGATCAATTCCGGCCTACAGTTTCCCTTCG
CGGACAAGAACGGCGCGGCGGTGCGCGGCGTGGGCGGCACGCGCAACTGCGACTGGTTCTTCACCACCGA
AGGCATTCTGCTGGACACCGCCGGCCGCTACTCGGTGCACGAAGAAGACCGCAACGAATGGATGGGCTTC
CTCGACCTGCTCAAGCGGCACCGTCCCAAGGCCCCCATCAACGGCATCATCGTGGCCGCCAGCATCGACG
AGCTGACGGGCGCGGGACCCGAGTTCGCGATCAACCTGGCCAAGAACCTGCGCCAGCGCGTGCAGGAACT
GACCGACCGCCTGGAAGTGTTCGCGCCGGTCTACATCATCTTCACCAAGGCCGACCTGATCTCGGGCTTC
AGCGAGTTCTTCTCCGACAGCGACCAAAGCGAGCGCGACCGCGTGTGGGGCGCGACCCTGCCCTATGGCG
CCGAGGAAAACCGCGACGTGCTGGCGCTGTTCGACAGCCGTTTCGACGAGCTGTACGAGGGCCTGAAGGA
AATGGGCACGGCGCAGATCTCGCTGCGCAACAGCCGCGACCTGCCGCCGGGCCTGCTGACGTTTCCGCTG
GAATTCGCCGGCATCAAGCCGGCGCTGCGGACCTTCCTGTCGACGCTGTTCGAGACCAATCCATTCCAAT
ACAAGCCGGTGTTCCGCGGCTTCTACTTCACCAGCGCGCTGCAGGAAGGTGTCACGCAAAGCACTTCCAC
CGAGCGGCTGGCCGAACGCTTCGAGCTGCGTCCCGCGCAGCGCGCACAGACGCGCAGCGTGACCTCCAAC
AACGGCTTCTTCCTGCGCGACCTGTTCTCCAGCGTGATCTTCGCCGACAAGAAGCTGGTGCGCCAGCACG
CCAGTCCCGCCAAGACGCGCATGCGCTACCTGGCCTTCTTCGGCCTGGTGCTGGCGCTGGGGCTGGTGCT
GGGCGGTTGGAGCTGGTCCTACCTGGGCAACCGGCAACTGGCGCAGAACGTGCAGGCCGATCTCGACAAG
GTGGTGCGCCTGCAAAGCGAGCGCACCGACCTGCAAAGCCGGCTGGAAGCGATGGAGATCCTGCAGGATC
GCATCGAGCAGCTGGACCGCTATTCCTCCAGCCGGCCTTGGTCGCTGGGGCTGGGCCTGTATCAGGGCGA
CGTGCTGAAGGAGCGCCTGCTGGCCGAGTACTACAACGGCGCGCGCCAGTTCATGCTGGCGCCGGTGAAG
ACCAGCCTGGAGGACTTCCTGGCCAAGGTCGACACGTCCGCTACCGCAGCCAGTGGCGGCGCGCCCCAGC
CTGCGCCGCAGCAGGCCCGCGCCGCCCACGCGGCGGGCGGTGACACCCTGTTCCAGGACGCCTCGCCCAC
CAACGCCGACGACGCCTACAACGCGCTCAAGACCTACCTGATGATGGCGAATCATCAGCATGTGGACCCC
ACCCACCTGTCCGACCAGATAACCCGCTTCTGGCGCGGCTGGCTGGAGACCAACCGCGGCGCCATGCCGC
GCGACCAGTTGATCCGCAGCGCCGAGCGCCTGATCTCGTTCTATGTCGGCCGGGCGCAGGACGAAGGCTG
GCCGCAGATCGACACCAATCTGGCATTGGTCGAGAAGACCCGCGGCAGCCTGCGCGCCGTGATGCAGGGC
ATGCCGGCGCGCGAACGCGCCTATGCCACCCTTAAGGCGCGCGCCGCCACCCGCTTCCAGGCCATGACGG
TGGCGCGCATCGTCGGCGAGAACGACGCGGGCGTGGTCGCCGGCAGCTATGCCATCCCCGGCACGTTCAC
CCGCGAAGCCTGGGAGCAGTACATCCAGCCCGCCATCGGCGAGGCCGCCAAGAAGGAAGTGCAGACCAGC
GACTGGGTGCTGGGCGTGAACGCCCGCGACGACCTGACGCTGGAAGGCAGCCCCGAGCAGATCCAGAAAA
GCCTGGCGACGATGTACAAGACCGAGTACGCCGAGGAGTGGCAGAAATTCCTGCGCGGCGTGACGATCAA
GCCCTTCACCAGCTTCGAGCAATCAGTGGGCGCGATGAACCGCCTGGGCGATCCTCAGACCTCGCCCATC
GCCAAACTCATCAACACCACCTATGAACAGACCTCCTGGGACAACCCCTCGCTGATCAACGCCGGGCTGC
AGCAGGCGCAGAGCGGCGTCGTGGGCTGGTTCAAGCGCGTCATCCTGCGCCAGACGCCGCCGTCCGCCGC
GCCCGCCACCGCCGCCAACGGCGAAGCGATTCCGATGGGCCCCGTGGGACGCGAGTTCTCCGACGTGGCG
CGCCTGGTGGTCACGCGCGACAACCAGTCGCTGCTGGGCAACTACATGGGCGCGCTATCGAAGATCCGCA
CCCGCTTCAACCTGCTGAACAACCAGGGCGATCCCGGCCCCGGCGCGCTGACGCTGATGCGCCAGACGCT
GGAAGGCAAGGACTCGGAGCTGGCCGACGCGCTGAAGCTGGTGGACGAACAGATGCTGGCCGGCATGTCG
GCGACGCAGCGCGAGACGCTGCGTCCGCTGCTGGTGCGTCCGCTGATCCAGGCCTATGCCGTGACCATGC
AGCCGGCGGAATCCGAGCTGAACAAGGTCTGGAACGCACAGATCTATCGCCCGTTCAACCAGACGCTGGC
GGAGAAATATCCCTTCGCCAGCCGCGCCAGCGTCGAGGCCAGCAGCGATGAAATCGGCCAGGTGTTCGGT
CCACAGGGCAGCATCGCCAAGTACGTCAACGACACGCTGGGCCCGCTGACCGTGCGCCGCGGCGACATCC
TGACGGCGCGCACCTGGGGCGACATGGGCGTGAGCCTGCAGCCCACCTTCACCGCCAACTTCGCACAGTG
GGTGGCTCCGCTCTCCGGCGGCGCGGCCGGCAGCGGCGCAGCCAGCCAGCCGCAGACGCTGTTCCAGATC
CAGCCCAAGCCCGCCGCCGGCGTGACCGAATACACCATCGAGATCGACGGACAGCAGCTGCGCTACCGCA
ACACCCCGCCGCAATGGGTCAATTTCGTGTGGCCCAACGCCCAGGGCGCCCCCGGCGCGCGCATCACCGC
CACCACCTTCGATGGCAGCGTGGTCGAGATCGTCAACGAGCCCGGCCGCTTCGGCCTGGAGCGCCTGATC
GCCACCGCCCAGCGCACCGCCAACGCCGACGGCAGCTTCAACATGAGCTGGGGTAAATCCAACGTGACGG
TGCCGGTGAAGCTGCGCATCATCAGCAACGCCCAGGCGCCCGGCGCCGGCGGCAGCGAGCCCGGCGGCAG
CCAGGGCCTGCGCAACCTGCGCCTGCCCTCGTCCGTGGTCGGCGCCTCTCCCGAATCCTCCGCCCAGACG
CAACCCGGAGCGCCGCAATGA
 Primer design