SecReT6
Protein ID: 311109538
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06383
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6860391..6864020 [-]
Producthypothetical protein
NoteTssM
UniProt IDE3HRQ7
KEGG IDaxy:AXYL_06383
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.70E-100, Aligned region: 95..133
ImcF-related_N [PF14331], Evalue: 1.70E-100, Aligned region: 207..475
IcmF-related [PF06761], Evalue: 7.70E-91, Aligned region: 524..834
DUF1215 [PF06744], Evalue: 7.40E-33, Aligned region: 125..138
DUF1215 [PF06744], Evalue: 7.40E-33, Aligned region: 946..1069
Protein Sequence: 1209 a.a.     [Download]
>gi|311109538|ref|YP_003982391.1| hypothetical protein AXYL_06383 [Achromobacter xylosoxidans A8]
MIYRLFGWFFSRRVWNFLGLVALAVLIWIAGPLIAIGTVRPLESETVRIAVIVAMFAIWLLRLLWRKWRE
GRLNAQLLSQLRRPKPKADKPLEEAAGNDEIRQLEARFHEAVELLRKTRFESRGRRGALDRFSKQYLYQL
PWYVIIGAPGAGKTTALVNSGLNFPLAERYGKVALRGVGGTRNCDWWFTDDAVLLDTAGRYTTHESDPTG
DEEEWRGFLGLLSKYRGRQPINGAMLTVSVEDLLSASDAERAQHAAVLRRRLQELREQLGIAFPVYVLVT
KTDLLSGFEEYFASFTREELAQIWGFTLPYARAQEPDFDLYEAFHEEYALLQRRLDDALPEVVAAESDPA
RRALAYMLPQQFAGLQAILGHFLSDVFATSKFEARVIPRGVYFTSGTQGGETFDQVTGHLKRYLRIDGGA
ASAASVPGEGEGRSYFLKNLLQDVIFREAGLASRNLRWERRYRQLHWAGYGLVTAAFVALIGGWAMSYRN
NADYVEEVARRVPAVEKLTRDIKITRTGDLLGLMPFLDSLWYLPQHEGFEIDNPPLSYRYGLYQGQKLQA
AAQGVYGNTLDQVLLPQVARRVETALRDASASDLEYSYEALRAYLMLYEAERYDAEFMHAWLLSDMQATL
PEGYTRRQYEQLSLHLRNLTQSHVLASPFPKDDALVAQAREKLARYTLAQRAYSRLRRTLANADAAPEIT
VVTLGGAQASAVFVRKSGKPLSQGIPALYSYRGYWDVFNKRVTGVAEVLRSDDAWILNIPLRSQLDQTAQ
RQLVVDIKRLYMNDYVAQWDGYLNDLQLAPSKSLLQNIQMARTLSAPESPLVRLVRGVARETSLLRDTGK
DDRSLVDQARDRVSSTREALEQMFGPTGPGAAMRADASDEKLERIVDQHFEPYRRLAEGEGATAGAASPI
AATTGLINELYTYLTAADAALRSGSPAPSSDAVTKLRAEAGRLPGPLRDVLNSLSVNASGEVSDVARARM
GETVSATIGMFCSQSVAGRYPFSGRSTRDVAPNDMARLFGPNGLMDDFFQKNLANQIDVSGQRWRFKPGI
DGKSGENSGTLDAFQRAGVIRDVYFMAGNPMPSYRVAIRPVEMDADITQFVMDVDGQAVRYAHGPQVATT
VQWPGPRGSNQVRIELTPQEGAAGMTTSGPWALNRMLDRAQLRRGATAEITLATFDLGGRKVVLEITASS
VKSPFHLAEMQAFACPGAS
 
Nucleotide Sequence: 3630 bp     [Download]
>ref|NC_014640.1|:c6864020-6860391 hypothetical protein AXYL_06383 [Achromobacter xylosoxidans A8]
ATGATCTACAGGCTGTTCGGATGGTTCTTCAGCCGCCGCGTGTGGAACTTCCTGGGGCTGGTGGCCCTGG
CGGTGCTGATCTGGATCGCAGGGCCGCTTATCGCGATCGGCACCGTGCGCCCGCTGGAAAGCGAAACAGT
GCGCATTGCGGTCATCGTGGCGATGTTCGCAATCTGGCTGCTGCGGTTGCTGTGGCGCAAATGGCGCGAG
GGGCGTTTGAACGCACAGTTGCTGAGCCAGCTGCGGCGGCCCAAGCCCAAGGCGGACAAGCCTTTGGAGG
AGGCCGCCGGCAATGACGAGATACGCCAGCTGGAGGCGCGGTTCCACGAGGCCGTGGAACTGCTGCGCAA
GACACGCTTCGAGAGCCGTGGCAGGCGCGGCGCGCTGGACCGGTTCTCCAAGCAGTATCTGTACCAGTTG
CCCTGGTACGTGATCATCGGTGCGCCGGGCGCGGGCAAGACCACCGCGCTGGTGAATTCGGGGCTGAACT
TTCCCCTGGCGGAACGCTATGGCAAGGTGGCCCTGCGGGGAGTGGGCGGCACCCGCAATTGCGACTGGTG
GTTTACCGACGATGCCGTGCTGTTGGACACGGCTGGGCGCTACACCACGCACGAAAGCGATCCGACTGGC
GACGAGGAAGAGTGGCGCGGCTTTCTCGGCCTGCTGTCCAAGTATCGCGGCCGGCAGCCCATTAATGGCG
CCATGCTGACGGTCAGCGTCGAAGACCTGCTGTCGGCTTCCGACGCGGAACGGGCGCAGCATGCGGCGGT
GTTGCGACGCCGGCTGCAGGAACTGCGTGAACAGTTGGGCATCGCGTTTCCGGTCTATGTGCTGGTGACC
AAGACCGACCTGCTGTCGGGCTTCGAAGAGTATTTCGCTTCCTTCACCCGCGAGGAACTGGCGCAGATAT
GGGGCTTCACCTTGCCGTATGCGCGCGCGCAGGAGCCGGACTTCGACCTGTACGAGGCCTTTCACGAGGA
ATATGCCCTGTTGCAGCGGCGCCTGGATGACGCCTTGCCCGAAGTGGTGGCGGCCGAGAGCGATCCGGCG
CGGCGCGCGCTCGCCTATATGCTGCCGCAGCAGTTCGCCGGCCTGCAGGCCATCCTGGGCCATTTCCTGA
GCGATGTGTTCGCGACCTCGAAATTCGAGGCGCGCGTCATTCCACGAGGCGTCTACTTCACCAGCGGCAC
GCAGGGCGGCGAAACCTTCGACCAGGTGACCGGGCATCTGAAGCGCTACCTGCGCATCGACGGCGGCGCC
GCGTCCGCGGCCAGCGTACCGGGTGAAGGAGAGGGCCGCAGCTACTTCCTGAAAAATCTGCTGCAGGACG
TGATCTTCCGCGAAGCGGGCCTGGCGAGCCGCAACCTGCGCTGGGAACGCCGCTACCGGCAGCTGCATTG
GGCGGGCTACGGCCTGGTGACAGCGGCCTTCGTGGCCTTGATCGGGGGGTGGGCGATGAGCTATCGCAAC
AACGCCGATTACGTGGAGGAAGTGGCGCGGCGCGTACCCGCAGTGGAGAAGCTGACGCGCGACATCAAGA
TCACGCGCACCGGCGACCTGCTGGGACTGATGCCCTTCCTGGACAGCCTCTGGTACCTGCCGCAGCATGA
AGGCTTCGAGATCGACAACCCGCCGCTGAGCTATCGCTATGGCCTCTACCAGGGCCAGAAACTGCAGGCG
GCGGCGCAGGGCGTGTACGGCAACACCCTGGACCAGGTGCTGCTGCCGCAAGTGGCGCGGCGCGTCGAGA
CCGCGTTGCGCGACGCCTCGGCCAGCGACCTGGAATATTCCTACGAGGCGCTGCGGGCCTATCTGATGCT
GTACGAGGCGGAGCGCTATGACGCGGAGTTCATGCATGCCTGGCTGCTGTCGGACATGCAGGCCACCTTG
CCCGAGGGCTACACGCGGCGCCAGTACGAACAGTTGTCGCTGCACCTGCGCAACCTGACGCAGAGCCATG
TGCTGGCCTCGCCGTTTCCCAAGGATGACGCGTTGGTGGCACAGGCGCGCGAGAAGCTGGCGCGCTACAC
GCTGGCGCAACGCGCCTACAGCCGGCTGCGCCGCACCCTGGCCAACGCCGATGCGGCGCCCGAGATCACG
GTGGTGACGCTGGGCGGCGCGCAGGCCAGCGCCGTCTTTGTGCGCAAGAGCGGCAAGCCGTTGAGCCAGG
GCATACCCGCGCTCTACAGCTATCGCGGCTACTGGGACGTGTTCAACAAGCGCGTCACCGGCGTGGCCGA
GGTGCTGCGGTCGGACGATGCGTGGATCTTGAACATACCCTTGCGCAGCCAGCTGGACCAGACGGCGCAA
CGCCAGCTGGTGGTGGACATCAAGCGCTTGTACATGAACGACTACGTGGCGCAGTGGGACGGCTATCTGA
ACGATCTGCAGCTGGCGCCCAGCAAATCGCTGCTGCAGAACATCCAGATGGCGCGCACCTTGTCGGCGCC
GGAGTCACCGCTGGTGCGGCTGGTGCGCGGCGTCGCGCGCGAAACCTCCTTGCTGCGCGATACCGGCAAG
GACGACCGTTCGCTGGTGGATCAGGCGCGCGACCGCGTCAGCAGCACGCGCGAGGCGCTGGAGCAGATGT
TCGGGCCGACCGGGCCGGGCGCGGCCATGCGGGCCGACGCCAGTGACGAGAAGCTGGAGCGCATCGTGGA
CCAGCACTTCGAACCCTACCGCCGGCTGGCCGAAGGCGAGGGCGCGACGGCCGGCGCTGCTTCTCCGATC
GCCGCAACCACGGGCCTCATCAACGAACTCTATACCTATCTGACGGCGGCGGACGCGGCCTTGCGCAGCG
GCAGTCCCGCGCCCAGTTCGGATGCCGTGACCAAGCTGCGGGCGGAGGCGGGACGCCTGCCCGGGCCGTT
GCGCGACGTGCTCAATTCCCTGTCCGTGAACGCGTCCGGCGAGGTGTCCGACGTGGCCCGGGCGCGCATG
GGCGAGACCGTGTCCGCCACCATAGGCATGTTCTGCAGCCAGTCCGTGGCCGGACGCTACCCGTTTTCCG
GCCGTTCCACGCGCGACGTGGCGCCCAACGACATGGCGCGGCTGTTCGGGCCCAACGGCCTGATGGACGA
CTTCTTCCAGAAGAACCTGGCGAACCAGATCGATGTGTCCGGACAGCGCTGGCGCTTCAAGCCCGGCATC
GATGGCAAGTCGGGGGAGAACTCCGGCACGCTGGATGCCTTCCAGCGCGCCGGCGTCATCCGCGACGTGT
ACTTCATGGCGGGCAACCCCATGCCCTCGTACCGGGTGGCCATCAGGCCCGTGGAAATGGACGCGGACAT
TACCCAGTTCGTGATGGACGTGGACGGCCAGGCGGTGCGCTACGCGCACGGCCCGCAGGTCGCGACCACG
GTGCAGTGGCCCGGCCCCCGCGGCAGCAACCAGGTGCGCATAGAGCTTACGCCGCAGGAAGGGGCGGCGG
GCATGACCACATCCGGCCCCTGGGCGCTGAACCGCATGCTGGATCGCGCCCAACTGCGGCGCGGCGCCAC
GGCGGAAATCACGCTGGCCACATTCGACCTGGGCGGGCGCAAGGTGGTGCTGGAGATCACCGCCAGCAGC
GTCAAAAGCCCTTTTCATCTGGCCGAGATGCAGGCCTTTGCCTGCCCCGGCGCGTCATGA
 Primer design