SecReT6
Protein ID: 311109539
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06384
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6864017..6865294 [-]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDE3HRQ8
KEGG IDaxy:AXYL_06384
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.40E-75, Aligned region: 37..242
DUF2077 [PF09850], Evalue: 2.40E-75, Aligned region: 373..404
OmpA [PF00691], Evalue: 8.30E-17, Aligned region: 309..406
Protein Sequence: 425 a.a.     [Download]
>gi|311109539|ref|YP_003982392.1| type VI secretion system OmpA/MotB family protein [Achromobacter xylosoxidans A8]
MHASDHTLAGPPGGMGDGAASTAGRLRPHDYVISGTNPLVAAANPLLDLIPQIRATAAHPSPAMLREHLL
DEVRQFELRAQQAGIPNETILGARYCLCTALDEAAALTPWGGGGVWSAHSLLVTFHNETWGGEKFFQLLA
KLSQNPGQHLDLLELLYYCLLLGFEGRYRVIDNGRSQLETLRQRLLRILRGARGEYPLALSPHWRDEPAQ
TPLRRLPVPLWVFGALAAVLALALYWGLGWRLGSQSDAVFASIAKLRPPTVQIAPTAVKRPAPAPRLAVF
LAPEIRDQLVSVRDEVDRSVVVLRGDGVFESGASSVRDQYLPVLSRVADALRETQGSILVRGYSDNTPMR
SARFPSNWHLSQARADAVKDMLEQRLGQTARVRAEGRGDADPVAPNDTAAGRALNRRVEITVLVPPPAHE
QGGQE
 
Nucleotide Sequence: 1278 bp     [Download]
>ref|NC_014640.1|:c6865294-6864017 type VI secretion system OmpA/MotB family protein [Achromobacter xylosoxidans A8]
ATGCATGCTTCGGATCACACGCTGGCCGGCCCTCCGGGCGGCATGGGCGATGGCGCTGCCAGTACGGCGG
GCAGGCTGCGGCCCCACGACTACGTCATCAGCGGCACCAATCCGCTGGTGGCGGCGGCGAACCCGCTGCT
GGACCTGATTCCGCAGATCCGCGCAACGGCGGCCCATCCGTCGCCCGCGATGCTGCGCGAGCACCTGCTG
GACGAGGTGCGCCAGTTCGAGCTGCGCGCGCAGCAGGCGGGCATACCCAACGAAACCATACTGGGCGCGC
GCTATTGCCTGTGCACGGCATTGGACGAGGCCGCCGCGCTCACGCCATGGGGCGGGGGCGGGGTGTGGTC
CGCGCACAGCCTGCTGGTCACTTTCCACAACGAGACCTGGGGCGGCGAAAAGTTCTTCCAGCTGCTGGCC
AAGCTGTCGCAGAACCCGGGGCAGCATCTGGATCTGCTGGAGCTGCTGTACTACTGCCTGCTGCTGGGTT
TTGAAGGACGCTACCGCGTGATCGACAACGGCCGCTCGCAGCTGGAGACGTTGCGGCAGCGCCTGTTGCG
GATCCTGCGCGGCGCGCGCGGCGAGTATCCACTAGCGTTGTCGCCCCATTGGCGCGACGAACCGGCGCAG
ACGCCCTTGCGCCGCTTGCCCGTGCCGCTGTGGGTGTTCGGCGCATTGGCCGCCGTGCTGGCGCTGGCGC
TGTACTGGGGCCTGGGCTGGCGCCTGGGCAGCCAATCCGACGCCGTGTTCGCATCCATCGCCAAGCTGCG
TCCGCCTACCGTGCAGATCGCGCCGACGGCGGTGAAGCGGCCGGCGCCTGCGCCGCGGCTGGCGGTGTTC
CTGGCGCCCGAGATCCGCGATCAGTTGGTCTCCGTGCGCGACGAGGTGGACCGTAGCGTGGTGGTGCTGC
GGGGCGACGGCGTGTTCGAGTCGGGCGCCAGTTCCGTGCGCGACCAGTATCTGCCGGTGTTGTCGCGCGT
GGCCGATGCCTTGCGCGAGACGCAGGGCAGCATTCTGGTGCGCGGCTACTCCGACAATACGCCGATGCGC
AGCGCGCGCTTCCCGTCCAACTGGCACCTGTCGCAGGCGCGCGCGGATGCGGTCAAGGACATGCTGGAGC
AGCGCCTGGGCCAGACGGCCAGGGTGCGCGCGGAGGGCCGCGGCGATGCCGATCCGGTGGCGCCCAACGA
CACGGCTGCGGGCCGCGCGCTGAACCGGCGAGTGGAGATCACGGTGCTGGTGCCGCCGCCGGCGCACGAG
CAGGGAGGACAGGAATGA
 Primer design