SecReT6
Protein ID: 311109540
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06385
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6865322..6866656 [-]
Producthypothetical protein
NoteTssK
UniProt IDE3HRQ9
KEGG IDaxy:AXYL_06385
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.10E-157, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|311109540|ref|YP_003982393.1| hypothetical protein AXYL_06385 [Achromobacter xylosoxidans A8]
MVSRDKVIWSEGMFLRPQHFQQFERHMLHTAQQRAAALQGFFWGFSQLSLDRDALAIGKVALTRAQGVMP
DGTPFDFSHPDAAPAAFEVPAQTRGARILLALPRVRAGASDVIYEGEEDTLARYLVHEAEVEDSGSVALE
PVLMQLGRLRLRLMLEDELTDDWLGLGVARILERRSDNRVVLDEGYIAPWVAAGEHPVLRGFVDELHGLL
DARSEALAARLSQPGRGGVSEVSDFMLLETVNRYMGSVWHARQSPAQHPERLFHDWLMLACDLATFTSAT
RRPGVLPGYAHDDLQGSFTPLMNELRRSLSAVLEQRALQIPLQDRGQGVRVAQIQDAELLQSAGFVLAVH
ADLGVEAVRMRFPAQVKIGPVERIRDLVHLQLPGVAVRALPVAPRQIPYSAGHVYFELDKSGEFWKQLER
TGALALHLAGDFPGLTMEFWALRD
 
Nucleotide Sequence: 1335 bp     [Download]
>ref|NC_014640.1|:c6866656-6865322 hypothetical protein AXYL_06385 [Achromobacter xylosoxidans A8]
ATGGTGAGCAGAGACAAAGTGATCTGGTCGGAGGGTATGTTCCTGCGGCCCCAGCATTTCCAGCAGTTTG
AACGCCATATGCTGCACACCGCGCAGCAGCGCGCGGCCGCGCTCCAGGGGTTCTTCTGGGGCTTCAGCCA
GCTGTCGCTGGACCGCGACGCGCTGGCGATAGGCAAAGTGGCGCTGACGCGGGCGCAAGGCGTCATGCCC
GATGGCACGCCATTCGATTTTTCGCACCCGGACGCGGCGCCGGCGGCGTTCGAAGTGCCGGCGCAAACGC
GCGGCGCGCGCATCCTGCTGGCCCTGCCGCGCGTGCGCGCCGGCGCCAGTGACGTCATCTACGAAGGCGA
GGAAGACACGCTGGCGCGCTATCTGGTGCACGAGGCCGAGGTGGAGGACAGCGGATCGGTGGCCCTGGAA
CCCGTCCTGATGCAGCTGGGCCGCTTGCGCTTGCGGCTGATGCTGGAGGACGAGCTGACCGACGACTGGC
TGGGCCTGGGTGTGGCGCGCATCCTGGAGCGCCGCTCGGACAACCGAGTAGTGCTGGACGAGGGCTACAT
AGCGCCCTGGGTGGCGGCGGGCGAGCATCCGGTCCTGCGCGGCTTTGTCGATGAATTGCACGGATTGCTC
GACGCGCGCAGCGAGGCGCTGGCCGCGCGCTTGTCGCAGCCCGGCCGCGGCGGCGTCTCCGAGGTGTCGG
ACTTCATGCTGCTGGAGACCGTCAACCGCTATATGGGCTCGGTCTGGCATGCGCGCCAGAGCCCCGCGCA
GCATCCCGAGCGCCTGTTCCACGACTGGCTGATGCTGGCCTGCGACCTCGCCACCTTCACATCCGCGACG
CGGCGGCCGGGCGTATTGCCGGGGTATGCGCACGACGATCTGCAGGGCAGCTTCACGCCCCTGATGAATG
AGCTGCGTCGTTCGTTGTCAGCCGTGCTGGAGCAACGTGCCTTGCAGATTCCGCTGCAGGACCGGGGCCA
AGGCGTGCGCGTGGCGCAGATCCAGGATGCGGAGCTGTTGCAGTCGGCCGGCTTCGTGCTCGCGGTGCAT
GCGGATCTGGGCGTGGAGGCCGTGCGCATGCGCTTTCCGGCGCAGGTCAAGATCGGTCCGGTGGAACGCA
TCCGAGACCTGGTGCACCTGCAATTGCCGGGCGTCGCCGTGCGTGCGCTGCCGGTGGCGCCGCGGCAGAT
CCCATACAGCGCCGGACATGTCTATTTCGAATTGGATAAGAGCGGCGAATTCTGGAAACAGCTGGAGCGC
ACCGGCGCGCTTGCGCTGCATCTGGCGGGCGATTTTCCCGGGCTGACGATGGAGTTCTGGGCGCTGCGCG
ATTGA
 Primer design