SecReT6
Protein ID: 311109541
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06386
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6866675..6867214 [-]
Productlipoprotein 3
NoteTssJ
UniProt IDE3HRR0
KEGG IDaxy:AXYL_06386
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.60E-39, Aligned region: 20..164
Protein Sequence: 179 a.a.     [Download]
>gi|311109541|ref|YP_003982394.1| lipoprotein 3 [Achromobacter xylosoxidans A8]
MIPTGRRRIVAILAGVLAAALLAACSSTARRVPVPYAIELRADPKVNQNAGGRPSPVQVTIYELKSASIF
ESRDFFTLQGDAHAALGAELLNVDQVILKPGETKVVQYPGNAEARVVGVVAAYRELEQSKWRLLVALPEA
QNTNMYKVWQFSPNEETVKVAVKRDGLEEVDRSRSWWPF
 
Nucleotide Sequence: 540 bp     [Download]
>ref|NC_014640.1|:c6867214-6866675 lipoprotein 3 [Achromobacter xylosoxidans A8]
ATGATTCCGACGGGACGGCGACGCATCGTGGCGATTCTTGCGGGTGTGCTGGCGGCAGCGCTGCTCGCGG
CATGTTCGTCGACGGCCAGGCGCGTGCCCGTGCCTTATGCGATCGAGCTGCGCGCGGATCCCAAAGTCAA
CCAGAACGCGGGCGGCAGGCCGTCGCCGGTGCAGGTGACGATCTACGAGTTGAAGTCAGCCAGCATCTTC
GAATCGCGCGACTTTTTCACCTTGCAGGGCGATGCGCATGCGGCGCTGGGCGCTGAGCTGCTCAATGTCG
ATCAGGTGATCCTGAAGCCGGGCGAGACCAAGGTGGTGCAGTACCCCGGCAATGCCGAGGCGCGCGTGGT
GGGCGTGGTGGCGGCCTATCGCGAACTGGAGCAGAGCAAGTGGCGGCTGCTGGTGGCGCTGCCCGAGGCG
CAGAACACCAATATGTACAAGGTCTGGCAGTTTTCGCCGAATGAGGAGACGGTGAAAGTCGCGGTCAAGC
GCGACGGGCTGGAAGAAGTGGATCGCAGCCGTTCGTGGTGGCCTTTTTAG
 Primer design