SecReT6
Protein ID: 311109543
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06388
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6867753..6868514 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDE3HRR2
KEGG IDaxy:AXYL_06388
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.50E-08, Aligned region: 27..95
Protein Sequence: 253 a.a.     [Download]
>gi|311109543|ref|YP_003982396.1| FHA domain-containing protein [Achromobacter xylosoxidans A8]
MKLIVFQRAGDPAFDPIHAVFTAPGATIGRSLDNHLALPDPTRAICRVQAAIRVNDADAGFVLNLSSMSA
VSVNGQALARDQEVPLNPGDELQIGDYRLRADTGASEAAVAATSVVADDDIFSDLIGPGTLPVGSAPDVS
THPFDLDSAQARNPEDPLRHLPPGDGAVASALTDPLALFDAPGDGTPSIFSDGTPSALPADDALAEHRAH
PVDDALGRPRESADHRSASDHLREIGGYLRPAPVKPEPGGQDR
 
Nucleotide Sequence: 762 bp     [Download]
>ref|NC_014640.1|:6867753-6868514 FHA domain-containing protein [Achromobacter xylosoxidans A8]
GTGAAACTCATCGTGTTCCAGCGTGCCGGCGATCCGGCCTTCGACCCCATCCACGCCGTGTTCACGGCGC
CCGGCGCCACGATAGGCCGCAGTCTCGACAATCACCTGGCCCTGCCCGATCCCACGCGCGCCATCTGCCG
CGTGCAGGCGGCGATCCGCGTCAACGACGCGGACGCCGGCTTTGTGCTGAACCTGAGCAGCATGAGCGCC
GTCAGCGTCAATGGCCAGGCGCTCGCGCGGGACCAGGAAGTGCCGCTGAATCCCGGCGACGAATTGCAGA
TCGGCGATTACCGGCTGCGGGCAGATACGGGCGCGTCCGAAGCGGCGGTAGCCGCTACGTCCGTGGTCGC
CGACGACGACATCTTCAGCGACCTGATCGGCCCGGGCACCTTGCCCGTGGGCAGCGCGCCGGACGTCTCC
ACGCATCCCTTCGATCTGGACTCCGCCCAGGCGCGCAATCCGGAAGACCCCTTGCGCCACCTGCCGCCCG
GCGATGGCGCGGTGGCGAGCGCGCTCACCGATCCCCTGGCGCTGTTCGACGCGCCCGGCGATGGCACGCC
CAGCATCTTCTCGGACGGCACCCCGTCCGCCCTGCCCGCCGACGATGCGCTGGCCGAGCACCGCGCCCAT
CCCGTCGATGATGCCTTGGGCCGTCCGCGCGAGTCCGCGGACCATCGCAGCGCATCCGACCATCTGCGGG
AGATCGGCGGCTACTTGCGGCCCGCGCCCGTCAAGCCAGAGCCTGGCGGCCAAGACCGCTGA
 Primer design