SecReT6
Protein ID: 311109544
SecReT6 ID413
T6SS typei3
Gene symbolclpB3
Locus tagAXYL_06389
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6868519..6871128 [-]
Productchaperone protein ClpB
NoteTssH
UniProt IDE3HRR3
KEGG IDaxy:AXYL_06389
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 5.00E-39, Aligned region: 220..299
AAA_2 [PF07724], Evalue: 5.00E-39, Aligned region: 601..767
AAA [PF00004], Evalue: 1.90E-20, Aligned region: 222..354
AAA [PF00004], Evalue: 1.90E-20, Aligned region: 373..388
AAA [PF00004], Evalue: 1.90E-20, Aligned region: 607..690
ClpB_D2-small [PF10431], Evalue: 5.50E-15, Aligned region: 776..849
AAA_5 [PF07728], Evalue: 4.00E-12, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 4.00E-12, Aligned region: 286..300
AAA_5 [PF07728], Evalue: 4.00E-12, Aligned region: 606..724
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 126..161
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 267..301
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 576..651
AAA_16 [PF13191], Evalue: 6.20E-09, Aligned region: 746..789
AAA_22 [PF13401], Evalue: 3.60E-08, Aligned region: 222..302
AAA_22 [PF13401], Evalue: 3.60E-08, Aligned region: 605..629
AAA_22 [PF13401], Evalue: 3.60E-08, Aligned region: 668..689
Sigma54_activat [PF00158], Evalue: 1.20E-07, Aligned region: 150..190
Sigma54_activat [PF00158], Evalue: 1.20E-07, Aligned region: 208..238
Sigma54_activat [PF00158], Evalue: 1.20E-07, Aligned region: 377..392
Sigma54_activat [PF00158], Evalue: 1.20E-07, Aligned region: 605..706
AAA_17 [PF13207], Evalue: 6.80E-06, Aligned region: 223..276
AAA_17 [PF13207], Evalue: 6.80E-06, Aligned region: 605..661
Zeta_toxin [PF06414], Evalue: 9.20E-06, Aligned region: 220..243
Zeta_toxin [PF06414], Evalue: 9.20E-06, Aligned region: 412..445
Zeta_toxin [PF06414], Evalue: 9.20E-06, Aligned region: 597..646
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 204..241
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 606..626
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 717..739
NACHT [PF05729], Evalue: 1.40E-05, Aligned region: 222..258
NACHT [PF05729], Evalue: 1.40E-05, Aligned region: 606..634
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 204..246
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 276..314
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 457..481
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 604..632
AAA_25 [PF13481], Evalue: 6.00E-05, Aligned region: 784..802
AAA_18 [PF13238], Evalue: 9.20E-05, Aligned region: 222..254
AAA_18 [PF13238], Evalue: 9.20E-05, Aligned region: 607..635
AAA_14 [PF13173], Evalue: 9.20E-05, Aligned region: 279..312
AAA_14 [PF13173], Evalue: 9.20E-05, Aligned region: 605..721
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 214..239
AAA_29 [PF13555], Evalue: 0.00031, Aligned region: 604..631
TIP49 [PF06068], Evalue: 0.00062, Aligned region: 222..243
TIP49 [PF06068], Evalue: 0.00062, Aligned region: 271..302
TIP49 [PF06068], Evalue: 0.00062, Aligned region: 573..642
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 201..236
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 275..375
Arch_ATPase [PF01637], Evalue: 0.0015, Aligned region: 605..627
RNA_helicase [PF00910], Evalue: 0.0045, Aligned region: 223..243
RNA_helicase [PF00910], Evalue: 0.0045, Aligned region: 607..628
RNA_helicase [PF00910], Evalue: 0.0045, Aligned region: 706..725
Protein Sequence: 869 a.a.     [Download]
>gi|311109544|ref|YP_003982397.1| chaperone protein ClpB [Achromobacter xylosoxidans A8]
MSDIGRIDLFGKLNPLLYQTLEGATAFCKLRGNPYVELVHWVHQILHAQDSDLHRIARRFGLDMAALQAD
LTAELDRLPAGAGSVSDLSEHIDHAVERAWVLGSLRYGAARIRSAHLLAGLARTYALRHVLLGMSAQFSR
IVPDTLLEQLQEIVQGSPEDAAEAASVAAAGAPGEGGSALARFAVDLTARARAGEIDPVSGRDEEIRQLI
DVLMRRRQNNPLLAGEAGVGKTAVVEGLALRLAAGEVPPQLRDVALYLLDIGLLQAGAGVKGEFEQRLRG
VIDEVQASERPVVLFIDEIHTLVGAGGAAGTGDAANLLKPALARGQLRTIGATTWSEYKKYIEKDPALSR
RFQVVQVHEPDEARAFGMLRGLAETLQAHHGVLLLDEAIEAAVTLSHRYIPARQLPDKAVALLDTACARV
AVSQHAVPPSLEDARRRVQALELAQRIAERELRLGEGDAQRIQRLAAEQAGAADDERTLAARWESERALA
GHVLTLRKTLDLAASDAQEDQRRALAQARVALAASQGETAMVHCAVDAAAVAAVVADWTGIPVGRMLRDE
ARAVLDLADTLSTRVIGQREALEAVARRVQTSRAGLTDPDKPVGVFLLCGPSGVGKTETALALAEALYGG
EQNLITINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEVEKAHADVHEIFFQVFD
KGWMEDGEGRYIDFRNAVIILTSNVGADRIAALCRDPELLPDSVALAAALREQLLQAFPAALLGRLVAVP
YLPLPDTMLARIVDLQFERVRRRLSEHHGIVLEVTPEATALVVARCAEVESGARMVDAVLTNTVLPRISR
ELLGASMQDRRLSRVGLSAADGEFRYDYA
 
Nucleotide Sequence: 2610 bp     [Download]
>ref|NC_014640.1|:c6871128-6868519 chaperone protein ClpB [Achromobacter xylosoxidans A8]
ATGTCGGATATCGGCCGCATCGACCTCTTCGGAAAGCTCAATCCGCTGCTCTACCAGACGCTGGAGGGCG
CCACCGCGTTCTGCAAGCTGCGCGGCAATCCCTATGTGGAACTGGTGCATTGGGTGCATCAGATCCTGCA
TGCGCAAGACAGCGACCTGCACCGGATTGCGCGCCGCTTCGGACTGGACATGGCGGCATTGCAAGCCGAC
CTGACGGCGGAGCTGGACCGCCTGCCGGCCGGGGCGGGTTCGGTGTCCGATCTGTCCGAACACATTGATC
ACGCAGTCGAAAGGGCCTGGGTGTTGGGGTCGCTGCGCTATGGCGCGGCACGCATCCGCAGCGCCCATCT
GCTGGCGGGACTGGCGCGGACCTACGCGCTGCGCCACGTGCTGCTGGGCATGTCGGCGCAGTTCTCGCGC
ATCGTGCCGGATACGCTGCTGGAACAGCTGCAAGAGATCGTGCAGGGCTCGCCGGAAGACGCGGCCGAGG
CGGCGTCCGTTGCCGCCGCCGGGGCGCCGGGCGAGGGCGGTTCCGCGCTTGCGCGCTTCGCGGTCGATCT
GACCGCTCGCGCGCGCGCGGGCGAGATCGATCCGGTATCCGGACGCGACGAGGAAATCCGCCAGCTCATC
GATGTGCTGATGCGGCGGCGCCAGAACAACCCGCTACTGGCCGGCGAGGCCGGCGTCGGCAAGACGGCCG
TGGTGGAAGGCCTGGCGCTGCGCCTGGCGGCGGGAGAGGTGCCACCGCAGCTGCGCGACGTTGCGCTGTA
TCTGCTGGACATCGGCCTGTTGCAGGCGGGCGCGGGCGTGAAGGGCGAGTTCGAGCAACGGCTGCGCGGC
GTCATAGACGAGGTGCAGGCCAGCGAGCGGCCGGTGGTGCTGTTCATCGACGAGATCCACACGCTGGTGG
GCGCAGGCGGCGCCGCGGGCACAGGGGACGCGGCCAACCTGTTGAAGCCTGCGCTGGCGCGCGGCCAGCT
GCGCACCATAGGCGCCACCACCTGGTCGGAATACAAGAAGTACATCGAGAAGGACCCCGCGCTGAGCCGC
CGCTTCCAGGTCGTCCAGGTGCACGAGCCCGACGAGGCGCGTGCATTCGGCATGCTGCGGGGCCTGGCTG
AAACGCTGCAGGCCCATCATGGCGTGCTGCTGCTGGACGAGGCGATCGAGGCGGCGGTGACCTTGTCGCA
TCGCTATATTCCCGCGCGCCAGCTGCCTGACAAGGCGGTGGCGCTGCTGGACACGGCCTGCGCGCGCGTC
GCGGTCAGCCAGCATGCGGTGCCGCCCAGCCTGGAGGACGCGCGCAGGCGGGTCCAGGCACTGGAGTTGG
CGCAGCGCATCGCCGAACGTGAACTGCGCCTGGGCGAAGGCGACGCGCAGCGGATCCAGCGCCTGGCGGC
CGAGCAGGCCGGCGCCGCGGACGATGAGCGGACGCTGGCGGCGCGCTGGGAGTCGGAACGTGCGTTGGCC
GGGCATGTGCTGACATTGCGCAAGACGCTGGACCTTGCTGCGTCCGATGCGCAGGAAGACCAGCGCCGCG
CGTTGGCGCAGGCGCGCGTAGCGCTGGCGGCCAGCCAGGGCGAGACGGCGATGGTGCATTGCGCGGTCGA
CGCGGCGGCGGTCGCGGCGGTGGTGGCCGACTGGACCGGCATCCCCGTGGGCCGCATGCTGCGGGACGAG
GCGCGCGCCGTGCTGGATCTGGCGGATACGCTGTCGACGCGGGTGATCGGCCAGCGCGAAGCGCTGGAGG
CGGTGGCGCGCCGGGTCCAGACCTCTCGTGCCGGCTTGACCGACCCGGACAAGCCGGTGGGCGTGTTCCT
GCTCTGCGGCCCCAGCGGCGTCGGCAAGACGGAGACCGCGCTGGCCCTGGCCGAAGCGCTCTACGGTGGC
GAGCAGAACCTGATCACGATCAACATGAGCGAGTTCCAGGAGTCGCATACGGTGTCCACGCTCAAGGGCG
CGCCGCCTGGATACGTGGGCTATGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGCAGGCGGCCCTACAG
CGTGGTGCTGCTGGACGAGGTGGAGAAGGCGCACGCCGACGTGCATGAGATCTTCTTCCAGGTCTTCGAC
AAGGGCTGGATGGAGGACGGCGAGGGGCGCTACATCGATTTCCGCAACGCGGTGATCATCCTGACCTCCA
ACGTGGGTGCGGACCGCATCGCGGCGCTGTGCCGCGACCCGGAGCTGTTGCCGGACAGCGTCGCGTTGGC
CGCGGCATTGCGCGAGCAGCTGCTGCAGGCCTTTCCGGCCGCTCTGCTGGGGCGGTTGGTCGCGGTGCCG
TACCTGCCGTTGCCGGACACCATGCTGGCACGCATCGTGGACCTGCAATTCGAGCGCGTGCGCCGCCGCC
TGTCGGAGCACCACGGCATCGTGCTGGAGGTGACGCCCGAAGCCACCGCGCTGGTCGTGGCGCGATGCGC
CGAAGTGGAGTCGGGGGCGCGCATGGTGGATGCCGTGCTCACCAACACGGTGCTGCCCAGGATCAGCCGG
GAGCTGCTGGGCGCTTCGATGCAGGACCGCAGGCTGAGCAGGGTAGGCCTGTCAGCCGCCGACGGGGAGT
TCCGTTATGACTACGCCTGA
 Primer design