SecReT6
Protein ID: 311109545
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06390
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6871143..6872246 [-]
Producthypothetical protein
NoteTssG
UniProt IDE3HRR4
KEGG IDaxy:AXYL_06390
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.00E-113, Aligned region: 30..330
Protein Sequence: 367 a.a.     [Download]
>gi|311109545|ref|YP_003982398.1| hypothetical protein AXYL_06390 [Achromobacter xylosoxidans A8]
MDIAQPLAAAENPPAAPDGALAQWWRALEREPHAHDLFHALRWIDALSGARKPLGRDTVARHEPVRLRQE
PSMAFAPSTVAGARAAMGGQPAELSIFSFGLFGPNGPLPLHLTEHARERMAHHGDRTLSAFADVFHHRLI
LLFYRAWADAQSTVSLDRKDERFTRYVASLLHMGEPSMRRRDAVLDHAKYHMAGHLTRQTRNPEGLKHIL
QSFFGLPVRIREFVPQWIRLEPAQRLGLGGLAGLGRDTVLGIAVRDAQHKFRIEIGPLALADYQSFLPGG
ERARQLTHWVRHYIGMELAWDLRPVLRAQDARGLALGAQRPLGLSSWLGKRRPEQGEAGDLLLDYESRGR
IPPRGRLPASTSTTTRA
 
Nucleotide Sequence: 1104 bp     [Download]
>ref|NC_014640.1|:c6872246-6871143 hypothetical protein AXYL_06390 [Achromobacter xylosoxidans A8]
GTGGACATCGCCCAACCCCTTGCCGCTGCCGAAAATCCGCCCGCCGCGCCAGACGGCGCGCTGGCGCAAT
GGTGGCGCGCGCTGGAGCGCGAACCGCACGCCCACGACCTGTTCCATGCCTTGCGCTGGATAGATGCGCT
CTCCGGGGCGCGCAAGCCGCTGGGCCGCGACACGGTCGCGCGCCACGAACCCGTGCGGCTGCGGCAGGAG
CCGTCGATGGCATTCGCGCCATCCACCGTAGCGGGCGCGCGCGCAGCCATGGGCGGCCAGCCCGCGGAAC
TGTCGATATTCAGCTTCGGCCTGTTCGGTCCGAACGGGCCCTTGCCTCTGCATCTGACGGAACACGCTCG
CGAGCGCATGGCGCATCACGGCGACCGCACGCTGTCTGCATTCGCGGACGTGTTCCACCATCGGCTCATC
CTGCTGTTCTACCGCGCCTGGGCCGATGCGCAGAGCACGGTCAGCCTGGATCGCAAGGATGAGCGCTTCA
CGCGCTACGTGGCCAGCCTGCTGCACATGGGCGAACCGTCGATGCGGCGCCGCGACGCCGTGCTGGACCA
TGCCAAGTACCACATGGCGGGGCATCTGACGCGCCAGACCCGCAATCCGGAAGGACTCAAGCACATCCTG
CAATCGTTCTTCGGCCTGCCGGTGCGCATCCGCGAGTTCGTGCCGCAGTGGATCCGCCTGGAACCGGCAC
AGCGACTGGGGCTGGGCGGCTTGGCGGGGCTGGGGCGTGACACCGTGCTGGGGATCGCGGTGCGCGATGC
CCAGCACAAGTTCCGCATCGAGATCGGTCCCTTGGCGCTGGCGGACTACCAGAGCTTTCTGCCTGGAGGC
GAGCGCGCCCGGCAGCTGACGCATTGGGTCAGGCATTACATCGGCATGGAGCTGGCCTGGGATCTGCGCC
CGGTGCTGCGTGCGCAGGATGCGCGCGGACTGGCCCTTGGGGCGCAGCGACCGCTGGGCCTCTCTTCGTG
GCTGGGCAAGCGCCGGCCCGAGCAAGGCGAAGCTGGCGATCTCCTGCTGGATTATGAAAGCCGCGGCCGT
ATCCCGCCGCGTGGCCGCTTGCCGGCTTCAACCTCAACGACCACGCGCGCCTGA
 Primer design