SecReT6
Protein ID: 311109547
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06392
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6872912..6874816 [-]
Producthypothetical protein
NoteTssF
UniProt IDE3HRR6
KEGG IDaxy:AXYL_06392
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.40E-212, Aligned region: 5..633
Protein Sequence: 634 a.a.     [Download]
>gi|311109547|ref|YP_003982400.1| hypothetical protein AXYL_06392 [Achromobacter xylosoxidans A8]
MDDRLLDYYNRELVYLRELGAEFAQAHPKVAGRLGMNATEVADPYVERLLEGFSFLTARIHMKMDAEFPR
FSQRLLEVVYPNYLAPTPAMAIVQFAPSMNEGTLAGGFELPRGTLLRGRVARGEQTPCDFTTGHALRLWP
LQVTQAEFTAAPQDLPLARLGLTGRTARVLSALRIRIEVCGGQRLEDLDLDQLVFHLNGQDLQMQRLLEV
VMGHTVAVLGHDAARPLAWINRLPPGAVRHEGFADEQALLPGDARVFQGYRLLQEYFAFAQRYLFFSING
LKRGLRTPAMPQGAQRETRAFDLTLLFSMAAPELEGAISAANLALHCAPVINLFAKRADRVAVTPRTSEY
HVVIDRSRPLDYEVYGVTRVAGHASAQRQEQEFRPFYGSLGSDPDEHGAYFSVRREARLVSDIAQRNGTR
SGYIGSEVFLSLVDRREAPFSGDLRHLTLETLCTNRDLALLLPLGTETDMTLRVSAPVRSVKVLHGPTRP
RAALAENAATWHLISHLGLNYLSLTDLDAEQGAQTLREMLHVYGSLAEPATRRHIAGLRHVSATPVHHRL
PVPGPIVHGRGVRIALQVDETAFSGISPYLFGAVLEQFFARHVSINLMSELVLSSLQRGEIARYQPRMGR
RPVV
 
Nucleotide Sequence: 1905 bp     [Download]
>ref|NC_014640.1|:c6874816-6872912 hypothetical protein AXYL_06392 [Achromobacter xylosoxidans A8]
ATGGACGATCGCCTGCTGGATTACTACAACCGGGAACTGGTCTATCTGCGGGAGCTGGGCGCGGAATTCG
CGCAAGCCCATCCCAAGGTGGCCGGACGCCTGGGCATGAATGCGACCGAGGTGGCCGATCCCTATGTCGA
GCGCTTGCTGGAGGGCTTCAGCTTTCTGACTGCCCGCATCCATATGAAGATGGATGCGGAATTTCCGCGT
TTCTCGCAACGGCTGCTGGAGGTGGTGTACCCCAACTACCTGGCGCCCACGCCAGCGATGGCCATCGTGC
AGTTTGCGCCCAGCATGAACGAGGGCACCTTGGCGGGAGGCTTCGAGCTGCCACGCGGCACGTTGCTGCG
CGGCCGCGTGGCGCGCGGCGAGCAGACGCCCTGCGACTTCACCACCGGCCACGCCCTGCGCCTGTGGCCC
CTGCAGGTCACGCAGGCGGAGTTCACAGCCGCGCCGCAGGATCTGCCGCTGGCGCGCCTGGGTCTGACGG
GGCGCACCGCGCGGGTGCTGAGCGCGCTGCGTATCCGGATAGAGGTATGCGGCGGACAACGGCTGGAAGA
CCTGGATCTCGATCAACTGGTGTTTCACTTGAACGGCCAGGACCTGCAGATGCAGCGCCTGCTGGAAGTC
GTGATGGGGCATACCGTGGCGGTGCTGGGCCATGACGCCGCACGGCCGCTAGCCTGGATCAACAGGCTGC
CCCCGGGCGCGGTGCGCCATGAAGGCTTTGCCGACGAGCAGGCGCTGTTGCCGGGCGACGCGCGCGTGTT
CCAGGGCTACCGGCTGCTGCAAGAGTACTTCGCGTTCGCGCAGCGCTATCTGTTCTTCAGCATCAACGGA
CTGAAGCGGGGGCTGCGCACGCCCGCGATGCCCCAAGGCGCGCAGCGCGAGACCCGCGCATTCGACCTGA
CCCTGTTGTTCTCGATGGCGGCGCCGGAACTGGAGGGCGCGATATCGGCCGCCAATCTGGCGTTGCATTG
CGCGCCGGTGATCAACCTGTTCGCCAAGCGGGCGGACCGCGTGGCGGTAACCCCCAGGACTTCCGAGTAC
CACGTGGTCATCGACCGCAGCCGCCCGCTGGACTACGAGGTCTACGGCGTGACGCGCGTGGCGGGCCACG
CTTCCGCACAGCGCCAGGAGCAGGAGTTCCGGCCATTCTATGGCTCGCTGGGCAGCGATCCCGACGAGCA
CGGCGCCTACTTTTCCGTGCGCCGCGAGGCGCGGCTGGTTTCGGACATTGCGCAGCGCAACGGCACCCGC
AGCGGCTACATCGGCAGCGAGGTGTTCCTGTCGCTGGTGGACCGGCGGGAAGCGCCGTTTTCCGGTGACC
TGCGCCACCTGACCCTGGAAACCCTGTGCACCAACCGCGATCTGGCGTTGCTGCTGCCGCTTGGGACCGA
GACCGACATGACCCTGCGCGTGTCGGCGCCGGTGCGCTCGGTGAAGGTGCTGCACGGACCCACGCGGCCG
CGCGCTGCGCTGGCGGAGAATGCCGCGACCTGGCATCTGATCAGCCACCTGGGCCTGAACTACTTGAGCC
TGACTGACCTGGACGCAGAGCAGGGCGCGCAAACCCTGCGCGAGATGCTGCACGTCTACGGCAGCCTGGC
CGAGCCCGCCACGCGCCGGCACATCGCCGGCCTGCGGCATGTCAGCGCCACGCCGGTGCATCATCGCCTG
CCGGTGCCAGGCCCCATCGTCCATGGGCGCGGCGTGCGCATTGCGCTGCAGGTGGACGAGACGGCGTTTT
CGGGCATCAGCCCCTATTTGTTCGGCGCCGTGCTGGAGCAGTTCTTCGCGCGCCACGTATCGATCAATCT
GATGTCGGAGCTGGTCCTCTCGAGCCTGCAGCGCGGTGAGATCGCCCGCTACCAGCCCCGCATGGGACGC
CGGCCCGTGGTCTAG
 Primer design