SecReT6
Protein ID: 311109548
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06393
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6874816..6875367 [-]
Producttype VI secretion system, lysozyme-related family protein 2
NoteTssE
UniProt IDE3HRR7
KEGG IDaxy:AXYL_06393
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.10E-21, Aligned region: 50..160
Protein Sequence: 183 a.a.     [Download]
>gi|311109548|ref|YP_003982401.1| type VI secretion system, lysozyme-related family protein 2 [Achromobacter xylosoxidans A8]
MGHADRPGDWEPLSRGQRAARDRLQPSLLDRLMDNDPAKREEPRENAMLTHEALRAAVLRDLRWLLNTVN
LQASQDLSAHRPVAASALNFGVRAMAGKRMSEIDWIDVEESIREAIAAFEPRILRSSVEVRCVSDAGTLE
HHNVLSLEIRGMLWCVPQPLEFLFRTDIDLESGHMDLRDLGGA
 
Nucleotide Sequence: 552 bp     [Download]
>ref|NC_014640.1|:c6875367-6874816 type VI secretion system, lysozyme-related family protein 2 [Achromobacter xylosoxidans A8]
ATGGGCCACGCAGACCGTCCGGGCGATTGGGAACCGCTGTCGCGCGGCCAGCGCGCGGCGCGGGACCGCC
TGCAGCCGTCGCTGCTGGATCGCCTGATGGATAACGATCCCGCCAAGCGCGAGGAACCGCGCGAAAACGC
CATGCTCACGCATGAGGCGTTGCGCGCGGCGGTGCTGCGGGACCTGCGTTGGCTGCTCAATACCGTGAAC
CTGCAGGCGTCCCAGGACTTGTCGGCGCATCGGCCGGTGGCCGCCTCCGCGCTGAACTTCGGCGTGCGGG
CCATGGCGGGAAAGCGCATGTCGGAGATCGATTGGATCGACGTGGAAGAGTCGATCCGCGAAGCGATAGC
CGCATTTGAGCCGCGCATCCTGCGCTCTTCGGTGGAAGTGCGCTGTGTGTCGGACGCTGGCACGCTGGAG
CACCACAACGTGCTGAGCCTGGAGATACGCGGCATGCTGTGGTGCGTGCCGCAGCCGCTCGAGTTCCTGT
TCCGCACGGACATCGACCTGGAGAGCGGCCACATGGATCTGCGCGATCTGGGTGGTGCCTGA
 Primer design