SecReT6
Protein ID: 311109549
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06394
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6875367..6876182 [-]
ProductImpE family protein
NoteTagJ
UniProt IDE3HRR8
KEGG IDaxy:AXYL_06394
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.50E-41, Aligned region: 144..269
Protein Sequence: 271 a.a.     [Download]
>gi|311109549|ref|YP_003982402.1| ImpE family protein [Achromobacter xylosoxidans A8]
MSIAAVPFGALSLAGQLDELQAQVRRQPADADLRAQLFQLLAVQGDWARAAEQLDVCGHLNAQARPTQVL
YASAIAAEREREAVLAGQGEPALLDEPADWLRDMISALRLDGTAPAQAAELRGKAFEEASTHAGLLELAA
QEAAQPFQWICDGDSRLGPVFEFLTGGRYVWLPFAGLKRVRLLAPEGLCDLIWAQAEIELTDGQARQGLV
PARYPAAPGSRMVELSDSAKLGRTTDWRTLHGDTYAGVGQKMWLTDAAETALLEVRKLELA
 
Nucleotide Sequence: 816 bp     [Download]
>ref|NC_014640.1|:c6876182-6875367 ImpE family protein [Achromobacter xylosoxidans A8]
ATGTCCATAGCTGCCGTTCCTTTCGGCGCGCTCAGCCTGGCTGGCCAGTTGGACGAGCTGCAGGCGCAGG
TGCGCCGGCAGCCCGCCGACGCGGACCTGCGCGCTCAGCTGTTCCAGCTGCTGGCGGTGCAGGGCGATTG
GGCGCGCGCGGCCGAGCAACTTGACGTCTGCGGGCATCTCAATGCGCAGGCGCGCCCGACGCAGGTGCTC
TATGCCAGCGCCATCGCGGCGGAGCGCGAACGCGAGGCGGTGCTCGCCGGGCAAGGCGAGCCTGCGCTGC
TGGATGAGCCCGCCGATTGGCTGCGGGACATGATATCGGCGCTGCGCCTGGACGGCACCGCGCCGGCCCA
GGCCGCCGAGCTGCGCGGCAAGGCTTTCGAGGAAGCCAGCACGCATGCCGGCCTGCTGGAGCTGGCGGCG
CAAGAGGCGGCGCAGCCGTTTCAGTGGATCTGCGATGGCGACAGCCGCCTCGGTCCGGTGTTCGAGTTCC
TGACGGGCGGGCGTTATGTCTGGCTGCCCTTTGCCGGACTCAAGCGCGTGCGCCTGCTGGCGCCGGAAGG
CCTGTGCGATCTGATCTGGGCGCAAGCCGAGATCGAACTGACCGATGGCCAGGCGCGGCAGGGCCTGGTG
CCGGCGCGTTACCCGGCGGCGCCGGGCTCGCGCATGGTCGAACTGTCGGACTCGGCCAAGCTGGGCAGGA
CGACCGATTGGCGTACGCTGCACGGCGATACCTATGCGGGCGTGGGGCAGAAGATGTGGCTGACGGATGC
CGCGGAAACGGCCCTGCTCGAGGTGCGCAAACTGGAGTTGGCGTGA
 Primer design