SecReT6
Protein ID: 311109550
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06395
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6876196..6876681 [-]
Producthypothetical protein
NoteTssD
UniProt IDE3HRR9
KEGG IDaxy:AXYL_06395
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.60E-38, Aligned region: 6..135
Protein Sequence: 161 a.a.     [Download]
>gi|311109550|ref|YP_003982403.1| hypothetical protein AXYL_06395 [Achromobacter xylosoxidans A8]
MAVDMFMKIDGANGESKDSNHKDWTDIVSFSWGATQPGNLASGGGLGAGKASFNDLHVVARIDKAAPAVM
KHCASGKHLSKIELSMCKAGGEQIEYSKITLEDVLVSSVQISGDRSAEGVVVNFAFQAAKVKQQYWEQTD
KGGKGAESLVAWDIKQNKEVG
 
Nucleotide Sequence: 486 bp     [Download]
>ref|NC_014640.1|:c6876681-6876196 hypothetical protein AXYL_06395 [Achromobacter xylosoxidans A8]
GTGGCAGTGGACATGTTCATGAAAATCGATGGAGCCAATGGCGAATCCAAGGACTCCAACCACAAGGACT
GGACCGACATCGTGTCCTTCTCGTGGGGCGCCACCCAGCCAGGAAACCTGGCCAGCGGCGGCGGCCTGGG
TGCGGGCAAGGCCAGCTTCAACGACCTGCACGTGGTGGCCCGCATCGACAAGGCCGCGCCCGCCGTGATG
AAGCACTGCGCCAGCGGCAAGCATCTCAGCAAGATCGAGCTGTCCATGTGCAAGGCGGGCGGCGAGCAGA
TCGAGTATTCCAAGATCACGCTGGAGGACGTGCTGGTGTCGTCGGTGCAGATTTCCGGAGATAGAAGTGC
GGAGGGCGTGGTGGTGAACTTCGCCTTCCAGGCCGCCAAGGTCAAGCAGCAGTACTGGGAGCAGACCGAC
AAGGGCGGCAAGGGCGCGGAAAGCCTGGTGGCCTGGGATATCAAGCAGAACAAGGAAGTGGGCTAG
 Primer design