SecReT6
Protein ID: 311109551
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06396
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6876735..6878237 [-]
Producthypothetical protein
NoteTssC
UniProt IDE3HRS0
KEGG IDaxy:AXYL_06396
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-194, Aligned region: 67..493
Protein Sequence: 500 a.a.     [Download]
>gi|311109551|ref|YP_003982404.1| hypothetical protein AXYL_06396 [Achromobacter xylosoxidans A8]
MTAVAKRADARAVETLQADDLSALLKKEFKPKTEQAQEAVEHAVRTLAHQALENSGVGLSSDAYRTIQAI
IAEIDRKMSEQINGVMHHPDFQQLEGAWRGLHYLVTNTETDELLKIRVMCMSKSELGRTLKRHKGVGWDQ
SPIFKRVYEEEYGQFGGEPIGCLVGDYYFDHSPPDVELLGEIAKISSAAHCPFIAGASPNVMQMDSWQEL
ANPRDLTKIFTNTEYAAWRSLRESEDSRYIGLAMPRFLARLPYGARTNPVDEFDFEEDTDGSNHDRYTWT
NSAYAMAANVNRSFKLYGWCTSIRGVESGGAVENLPCHSFPTDDGGVDLKCPTEIAISDRREAELAKNGF
MPLVHRKNSDFAAFIGAQSLQKPHDYYEADASANAKLAARLPYLFACCRFAHYLKCIVRDKIGSFRERDD
MERWLNDWIMNYVDGDPVNSSQETKARKPLAAAEVQVQEIEDNPGYYSAKFFLRPHYQLEGLTVSLRLVS
KLPSLKQNEG
 
Nucleotide Sequence: 1503 bp     [Download]
>ref|NC_014640.1|:c6878237-6876735 hypothetical protein AXYL_06396 [Achromobacter xylosoxidans A8]
ATGACCGCAGTGGCCAAACGCGCCGACGCGCGCGCTGTCGAGACCTTGCAGGCGGACGACCTGTCCGCCC
TGCTGAAGAAGGAATTCAAGCCCAAGACCGAGCAGGCGCAGGAGGCGGTGGAGCACGCGGTGCGCACGCT
GGCGCACCAGGCGCTGGAGAACAGCGGTGTCGGTCTGTCGTCGGACGCCTACCGCACGATCCAGGCCATC
ATCGCCGAGATCGACCGGAAGATGTCGGAGCAGATCAACGGCGTGATGCACCACCCCGATTTCCAGCAGT
TGGAGGGCGCGTGGCGCGGCCTGCATTACCTGGTCACCAATACCGAGACCGACGAGCTCCTGAAGATACG
CGTGATGTGCATGTCCAAGTCGGAGCTGGGCCGCACGCTCAAGCGGCACAAGGGCGTGGGCTGGGACCAG
AGCCCCATCTTCAAGCGGGTGTACGAGGAAGAGTATGGCCAGTTCGGCGGCGAGCCTATCGGTTGCCTGG
TCGGCGACTACTACTTCGACCATAGCCCGCCCGACGTGGAACTGTTGGGTGAGATCGCCAAGATCTCGTC
CGCCGCGCACTGCCCCTTTATCGCGGGCGCCTCGCCCAACGTGATGCAGATGGATTCGTGGCAGGAACTG
GCCAACCCGCGCGACCTGACCAAGATCTTCACCAACACGGAATACGCCGCATGGCGCAGCCTGCGCGAGT
CCGAGGACTCGCGCTACATCGGGCTGGCGATGCCGCGCTTCCTGGCGCGGCTGCCCTACGGCGCCCGGAC
CAATCCGGTCGACGAGTTCGACTTCGAGGAAGACACCGACGGCTCGAACCACGATCGCTACACCTGGACC
AATTCCGCCTACGCCATGGCGGCCAACGTGAACCGCTCGTTCAAGCTGTACGGCTGGTGCACGTCCATTC
GCGGCGTGGAATCGGGCGGCGCCGTGGAGAATCTGCCCTGCCATAGCTTTCCCACCGATGACGGCGGCGT
GGACCTGAAGTGCCCGACCGAGATCGCCATCAGCGACCGGCGCGAGGCCGAGCTGGCCAAGAACGGCTTC
ATGCCGCTGGTGCACAGGAAGAACTCCGATTTCGCTGCCTTCATCGGCGCGCAATCGCTGCAAAAGCCGC
ATGACTACTACGAGGCCGACGCCTCGGCCAACGCCAAGCTGGCCGCGCGGCTGCCCTATCTCTTCGCGTG
CTGCCGTTTTGCCCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTCCGCGAGCGCGACGAC
ATGGAGCGCTGGTTGAACGACTGGATCATGAATTACGTGGACGGCGATCCCGTGAACTCCTCGCAGGAAA
CCAAGGCGCGCAAACCGCTGGCCGCCGCCGAGGTGCAGGTGCAGGAAATCGAGGACAACCCTGGCTATTA
CTCCGCCAAGTTTTTCTTGCGGCCGCACTATCAGCTGGAAGGGCTGACGGTGTCGCTGCGGCTGGTTTCC
AAGCTGCCCTCGCTCAAACAGAACGAAGGCTGA
 Primer design