SecReT6
Protein ID: 311109552
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06397
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6878269..6878820 [-]
Producthypothetical protein
NoteTssB
UniProt IDE3HRS1
KEGG IDaxy:AXYL_06397
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.90E-58, Aligned region: 13..166
Protein Sequence: 183 a.a.     [Download]
>gi|311109552|ref|YP_003982405.1| hypothetical protein AXYL_06397 [Achromobacter xylosoxidans A8]
MATSLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKSETPQPEVGERKFLDIDID
NFDERMRSIQPRVAFQVPNTLTGEGNLNVDVTFESIDDFSPATVARKVGALNELLSARTQLANLLTYMDG
KTGAEELIGSVLKNPALMNALAAAPKPQEEPRASDAPATDPAA
 
Nucleotide Sequence: 552 bp     [Download]
>ref|NC_014640.1|:c6878820-6878269 hypothetical protein AXYL_06397 [Achromobacter xylosoxidans A8]
ATGGCGACCAGCCTGAAGGGAAGCGGCCAGAAGTTCATTGCAAGAAACCGCGCGCCGCGGGTGCAGATCG
AGTACGACGTGGAGATTTACGGCGCGGAGCGCAAGATCCAGCTGCCGTTCGTGATGGGCGTGCTGGCGGA
TCTGGCCGGCAAGTCCGAAACGCCGCAGCCGGAGGTGGGCGAGCGCAAGTTCCTGGACATCGATATCGAC
AACTTCGATGAACGCATGCGTTCCATCCAGCCGCGCGTGGCGTTCCAGGTACCCAACACGCTGACGGGCG
AAGGCAATCTGAACGTGGACGTCACGTTCGAGAGCATCGATGATTTCTCGCCCGCTACCGTCGCCCGAAA
AGTTGGCGCGCTGAACGAATTGCTGAGCGCGCGCACGCAGTTGGCAAACCTGTTGACGTACATGGACGGC
AAGACCGGCGCCGAGGAACTGATCGGCAGCGTGCTCAAGAACCCGGCGCTGATGAACGCGTTGGCGGCGG
CGCCGAAGCCGCAAGAGGAGCCGCGCGCATCCGACGCCCCTGCCACGGATCCCGCCGCCTGA
 Primer design