SecReT6
Protein ID: 311109553
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06398
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6878860..6879903 [-]
ProductImpA-related N-terminal domain-containing protein 2
NoteTssA
UniProt IDE3HRS2
KEGG IDaxy:AXYL_06398
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.30E-21, Aligned region: 52..112
Protein Sequence: 347 a.a.     [Download]
>gi|311109553|ref|YP_003982406.1| ImpA-related N-terminal domain-containing protein 2 [Achromobacter xylosoxidans A8]
MEFADILNTLDSRLPCGEDLEYDADFLQLQQAAAGRDEQQFGSTIIAAQPPDWREVERLARALLERTRDL
RIIGLLTSAWTEIRGLPGYSDGLALAVDTLERYWEPVHPRLDSVGENDPMPRMNALAAFGDMQGCARSVR
SASLVSGVHGQLTLRDTEALLDGSRQDADAYPGGRPRLVERLRQAWAQGNADAQALQSAADALRRMQKLV
ADKLGDAWTPDYAAMLRTLDLVLEATRDLQSAPQAEVLADDAPAAAAPSAAMHLAADGAARRQDLPIQSR
DEALAMLSKVCAYFEANEPGHPAPYLIRRAQQLIPMSFHDIIKNLAPQGLEQFEAWLPRSEANRQEP
 
Nucleotide Sequence: 1044 bp     [Download]
>ref|NC_014640.1|:c6879903-6878860 ImpA-related N-terminal domain-containing protein 2 [Achromobacter xylosoxidans A8]
ATGGAATTCGCCGACATCCTCAATACACTCGATTCACGTCTGCCCTGCGGGGAAGACCTCGAATACGACG
CTGACTTCCTGCAACTGCAGCAAGCCGCGGCGGGTCGCGACGAACAGCAGTTCGGCTCGACCATCATTGC
CGCGCAGCCGCCTGACTGGCGCGAAGTCGAACGCCTGGCCCGCGCGCTGCTGGAACGCACTCGCGACCTG
CGCATCATCGGCCTGTTGACCTCGGCCTGGACCGAGATCCGCGGACTACCGGGCTATAGCGATGGCCTGG
CGCTGGCCGTCGACACCCTGGAACGCTATTGGGAGCCGGTGCATCCCCGGCTCGACAGCGTCGGTGAAAA
CGATCCCATGCCCCGTATGAATGCGCTGGCGGCCTTTGGCGACATGCAGGGCTGCGCGCGCAGCGTGCGT
TCGGCCAGCCTGGTCAGCGGCGTGCACGGACAACTGACTTTGCGCGATACCGAGGCGCTGCTCGATGGCA
GCCGACAGGACGCAGACGCCTATCCGGGCGGGCGTCCGCGACTTGTCGAGCGCCTGCGCCAGGCCTGGGC
GCAAGGCAATGCCGACGCGCAGGCGCTGCAGTCCGCGGCCGACGCGCTGCGGCGCATGCAGAAACTCGTG
GCGGACAAGCTGGGTGATGCCTGGACGCCCGATTACGCCGCCATGCTTCGCACCCTGGACCTGGTGCTGG
AGGCGACGCGGGACCTTCAATCCGCGCCGCAGGCCGAAGTTCTGGCGGACGATGCACCCGCTGCTGCGGC
CCCTTCCGCCGCCATGCATCTCGCCGCCGACGGTGCGGCGCGCAGGCAGGACTTGCCCATCCAGTCGCGC
GACGAAGCGCTGGCGATGCTCTCCAAGGTGTGTGCGTACTTCGAGGCCAACGAGCCCGGCCATCCCGCGC
CTTATCTCATCCGCCGCGCCCAGCAGCTTATCCCGATGAGCTTTCACGACATCATCAAGAATCTGGCCCC
CCAGGGGCTGGAGCAATTCGAGGCATGGCTGCCGCGGTCCGAGGCAAACCGGCAGGAACCGTAA
 Primer design