SecReT6
Protein ID: 311109554
SecReT6 ID413
T6SS typei3
Gene symbol-
Locus tagAXYL_06399
StrainAchromobacter xylosoxidans A8
Repliconchromosome [GenBank: NC_014640] [Browse all T6SS(s) in this replicon]
Location [Strand]6880436..6882823 [+]
ProductRhs element Vgr family protein 4
NoteTssI
UniProt IDE3HRS3
KEGG IDaxy:AXYL_06399
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.10E-86, Aligned region: 31..333
Phage_base_V [PF04717], Evalue: 1.20E-23, Aligned region: 372..465
Phage_base_V [PF04717], Evalue: 1.20E-23, Aligned region: 612..620
DUF2345 [PF10106], Evalue: 8.80E-09, Aligned region: 635..708
Sarcoglycan_1 [PF04790], Evalue: 0.0043, Aligned region: 534..581
Sarcoglycan_1 [PF04790], Evalue: 0.0043, Aligned region: 626..706
Protein Sequence: 795 a.a.     [Download]
>gi|311109554|ref|YP_003982407.1| Rhs element Vgr family protein 4 [Achromobacter xylosoxidans A8]
MDRNVPSDRVVKAHTPLPPEQLKFRAMHGAESLSQLFELEVELVSESYSLDMKSLLGKPLTLEIETGSSA
PRYLGGHVTRCALVGRENNTSRYTIYRATVRPWLWYLTQTSDNKIFQNKSVPDVIREVLKDYDYPVEFKL
VDSYRNWEYCVQYQETDYAFISRLMEHEGIYFWFKHDKGKHTLVLTDDITQHEPVADYEQIPYYGPDRIT
VPREDHVHKWEVAEQITPGAFATTDYHPLTPAASLEARRNNPGAHDHGDLEMYEWQGGYTNPDDAEHYTR
VRLEDLQCRKEQSAGASNARGLATGHLFTLRNHPRQAENREYLVVSTYYRIRETGYASGQPDPGSFDLEF
VVLPSSTQFRAPRVTPVPRTHGPQTATVVGKEGEEIWTDKMGRIKVQFHWDRYGKKDENSSCWVRVSSPW
AGGGFGGIQLPRVRDEVIVDFIGGQPDRPIVIGRVFNANNLPPWDLPDNATQSGFLSRSKSGTPATANAL
MFEDKSGSERIWLHAERELCTEVEANEFHTTDVNRTTTIGENDTTKIGGNRDIKVTGTDNLRVEKTRDVF
VKGHEEYTVKASRTVNVKDGLMDEKFDNGLKTTVAAKGEEREITGLFKETLKNGEQVYVNEGDSLHHVKT
GALTEKAKGKVELLSTDANMDVKAKTAMRVESETSTMDLKAKGKIDMESTGSTVLVKADGNITLKTPADV
VLDAANVKDLSKESWLQATPFSIGLAVAKAEFGMHRLALFRTTVMLNGSFTNYALVSSIGQLVSYRTTGS
SYQFDAVAAEKVGLGASMMGLWSII
 
Nucleotide Sequence: 2388 bp     [Download]
>ref|NC_014640.1|:6880436-6882823 Rhs element Vgr family protein 4 [Achromobacter xylosoxidans A8]
ATGGACCGCAACGTGCCCAGCGATCGTGTCGTCAAGGCGCATACGCCCCTGCCGCCGGAACAGCTGAAGT
TCCGCGCCATGCATGGCGCCGAAAGTCTTTCACAACTGTTCGAGCTGGAGGTCGAGCTGGTCTCCGAGTC
GTACTCGTTGGACATGAAGTCGCTACTGGGCAAGCCTTTGACGCTGGAGATCGAGACCGGATCATCCGCG
CCGCGCTATCTCGGCGGACACGTCACGCGCTGCGCCCTCGTCGGTCGCGAGAACAACACCTCGCGCTACA
CCATCTATCGCGCCACGGTGCGCCCGTGGCTCTGGTACCTGACCCAGACCTCGGACAACAAGATCTTCCA
GAACAAGAGCGTGCCCGACGTCATCCGCGAAGTGCTGAAGGACTATGACTATCCTGTCGAGTTCAAGCTG
GTGGACAGCTACCGCAACTGGGAATATTGCGTCCAGTATCAGGAAACCGACTACGCCTTCATCAGCCGCC
TGATGGAGCACGAAGGCATCTACTTCTGGTTCAAGCATGACAAGGGCAAGCACACCCTGGTGCTTACCGA
CGACATCACGCAGCACGAACCCGTCGCGGACTACGAGCAGATCCCCTACTACGGGCCGGACCGCATCACC
GTCCCGCGCGAAGACCATGTCCACAAATGGGAAGTGGCCGAGCAGATCACCCCCGGCGCCTTCGCCACCA
CGGACTACCACCCGCTCACGCCCGCCGCCAGCCTGGAGGCGCGCCGCAATAATCCCGGCGCCCACGACCA
CGGCGACCTGGAGATGTACGAATGGCAAGGCGGCTACACCAACCCCGACGACGCGGAACACTACACGCGC
GTGCGACTCGAAGATCTGCAATGCAGAAAAGAGCAGAGCGCCGGCGCATCCAACGCGCGCGGGCTGGCCA
CGGGCCATCTCTTCACGCTGCGCAATCATCCGCGCCAGGCCGAGAACCGCGAATATCTCGTGGTCAGCAC
GTACTACCGTATCCGCGAAACGGGCTATGCCAGCGGCCAGCCCGACCCCGGCAGTTTCGACCTGGAGTTC
GTCGTGCTGCCGTCCAGCACGCAATTCCGCGCACCCCGTGTCACGCCAGTTCCCCGTACCCATGGGCCGC
AGACCGCCACGGTGGTGGGCAAGGAAGGAGAGGAAATCTGGACGGACAAGATGGGCCGCATCAAGGTGCA
GTTCCATTGGGACCGCTACGGCAAGAAGGACGAGAACAGCTCCTGCTGGGTGCGCGTATCCAGCCCCTGG
GCCGGCGGCGGCTTTGGCGGCATCCAGCTGCCGCGCGTGCGCGATGAGGTGATCGTAGACTTCATCGGCG
GCCAGCCCGACCGCCCCATCGTGATCGGCCGCGTCTTCAACGCCAACAATCTGCCGCCCTGGGACCTGCC
GGACAATGCCACGCAAAGCGGCTTCCTGAGCCGCTCCAAGAGCGGCACGCCGGCGACGGCGAACGCGCTC
ATGTTCGAGGACAAGAGCGGTAGCGAACGCATCTGGCTGCACGCGGAGCGCGAACTCTGCACCGAGGTGG
AAGCCAACGAATTCCATACGACGGATGTAAATCGCACGACCACCATCGGCGAAAACGACACCACCAAGAT
CGGCGGCAACCGCGACATCAAGGTCACCGGCACCGACAACCTGCGCGTCGAAAAGACCCGAGATGTGTTC
GTAAAGGGACATGAGGAATACACCGTCAAGGCGTCGCGCACGGTCAATGTGAAAGACGGCCTGATGGACG
AGAAGTTCGACAACGGCTTGAAGACGACTGTCGCGGCCAAGGGCGAGGAACGCGAGATCACTGGTCTCTT
CAAGGAGACGTTGAAGAACGGCGAGCAGGTCTACGTGAACGAAGGCGACTCGCTGCATCACGTGAAGACC
GGCGCGCTCACGGAGAAAGCCAAGGGCAAGGTCGAACTGCTTTCCACCGACGCGAACATGGACGTCAAGG
CCAAGACCGCGATGCGGGTGGAGTCCGAGACTTCCACCATGGATCTGAAGGCCAAGGGCAAGATAGACAT
GGAGTCGACAGGATCGACCGTGCTGGTCAAGGCCGACGGCAACATCACGTTGAAGACCCCTGCCGACGTC
GTGCTGGACGCCGCTAACGTCAAAGACCTTTCCAAGGAGAGCTGGCTGCAAGCCACGCCGTTCTCCATCG
GCCTGGCGGTGGCAAAGGCGGAATTCGGCATGCATCGCCTGGCGCTGTTCCGCACCACGGTCATGCTGAA
CGGTTCCTTCACCAACTACGCCCTGGTCAGCAGCATCGGCCAGCTGGTTTCCTACCGCACCACGGGCTCC
AGCTATCAGTTCGACGCCGTTGCCGCGGAAAAAGTCGGCTTGGGCGCCTCGATGATGGGCCTCTGGAGCA
TCATCTGA
 Primer design