SecReT6
Protein ID: 313200972
SecReT6 ID484
T6SS typeN/A
Gene symbol-
Locus tagMPQ_1230
StrainMethylovorus sp. MP688
Repliconchromosome [GenBank: NC_014733] [Browse all T6SS(s) in this replicon]
Location [Strand]1240286..1241620 [+]
Productompa/motb domain-containing protein
NoteTssL
UniProt IDE4QMW7
KEGG IDmep:MPQ_1230
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.70E-56, Aligned region: 59..269
OmpA [PF00691], Evalue: 2.10E-18, Aligned region: 327..426
Protein Sequence: 444 a.a.     [Download]
>gi|313200972|ref|YP_004039630.1| ompa/motb domain-containing protein [Methylovorus sp. MP688]
MNEDIVASEDGVSALGERSGIDDLGMGLRDTSTQLHFEAGPNYDDRLAAVLRATEEGRNAFLEAASILLR
ALAEIPNELNHQAMNGLHELLRQEIQLFTRLCEQANLRRDQMLAVRYALCTALDEAVNLRSLNEAGQENP
VAWTTQALLNEFHGDGEGGRKVFLLIGRLANAPQEHVHVLEVIHHLLSLGFMGDYRVQADGHRLIESIRH
RLYTLVASSREPVPRELSPHWRGAPQGKFRLLRSIPVWVSASVLLLVLFGQFVWYKYHLLNLSENLQKRI
SAIYLMEPAHSSLRLSELLATEIAQGKVRVEEDSAHAIVVFKGDGMFSGGLAMLSPATREIVEKVGRAVA
DVQGRVRVVGHSDNQKLSGKNPEFKNNQILSEKRAQAVVQVMTEMGVDNSRIEVAGMGDTQPITSNSTAS
GRAKNRRVEIEVFFAPASVTPKAQ
 
Nucleotide Sequence: 1335 bp     [Download]
>ref|NC_014733.1|:1240286-1241620 ompa/motb domain-containing protein [Methylovorus sp. MP688]
ATGAATGAAGACATAGTAGCTTCTGAGGATGGTGTTTCTGCCCTGGGTGAACGTAGCGGCATCGATGATT
TAGGGATGGGTTTACGCGATACCAGCACTCAACTGCATTTTGAGGCCGGTCCAAATTACGATGACCGTTT
AGCTGCTGTATTGCGGGCTACTGAAGAAGGACGGAATGCGTTTCTGGAGGCAGCTTCTATTTTGCTTCGC
GCATTGGCTGAAATCCCCAATGAACTTAATCATCAGGCGATGAATGGATTGCATGAGTTGCTCAGGCAGG
AAATTCAGTTGTTCACTCGCTTATGTGAGCAGGCGAACCTTCGCCGCGATCAGATGCTGGCGGTACGCTA
CGCTCTCTGTACAGCCCTGGATGAGGCGGTGAATCTACGCAGCTTGAATGAGGCTGGTCAGGAAAATCCG
GTTGCATGGACAACGCAGGCCTTGCTTAACGAGTTTCATGGGGATGGAGAAGGCGGACGTAAGGTATTTC
TTCTGATTGGTCGCCTGGCAAACGCTCCTCAAGAGCATGTCCACGTCCTGGAGGTCATCCACCATCTTTT
AAGTTTAGGGTTTATGGGGGACTACCGGGTACAAGCTGATGGACATCGGCTGATTGAGTCTATCCGTCAT
CGACTTTATACCCTGGTAGCTTCAAGTCGTGAGCCAGTTCCTCGTGAGCTATCGCCCCATTGGCGTGGGG
CGCCTCAGGGAAAGTTTCGCTTATTGCGCTCCATTCCCGTTTGGGTCTCAGCCAGCGTATTGCTACTCGT
GCTTTTTGGGCAATTCGTTTGGTACAAATATCACTTGCTTAATCTTTCTGAAAATCTGCAGAAACGCATC
TCTGCTATTTATTTGATGGAGCCAGCCCACTCCAGCTTGCGGCTATCTGAGCTTCTTGCTACTGAAATCG
CCCAGGGGAAAGTACGGGTGGAAGAAGATTCCGCTCATGCCATTGTCGTGTTTAAAGGCGATGGGATGTT
TTCAGGTGGTCTGGCCATGCTTAGTCCGGCCACTCGTGAAATTGTCGAGAAAGTAGGGCGAGCGGTGGCT
GATGTGCAAGGCCGTGTGCGCGTCGTTGGACATAGTGATAACCAGAAACTATCCGGCAAAAATCCTGAAT
TCAAAAACAATCAAATCCTTTCCGAAAAGCGGGCCCAAGCGGTTGTGCAAGTAATGACGGAAATGGGGGT
CGATAACTCACGCATTGAGGTCGCAGGGATGGGAGACACCCAGCCAATTACCTCCAACAGTACGGCCTCG
GGTCGGGCCAAAAATCGTCGAGTCGAGATTGAGGTGTTTTTTGCGCCAGCCTCCGTCACTCCCAAAGCCC
AATAA
 Primer design