SecReT6
Protein ID: 313200973
SecReT6 ID484
T6SS typeN/A
Gene symbolicmF
Locus tagMPQ_1231
StrainMethylovorus sp. MP688
Repliconchromosome [GenBank: NC_014733] [Browse all T6SS(s) in this replicon]
Location [Strand]1241633..1243747 [+]
Producttype VI secretion protein icmf
NoteTssM
UniProt IDE4QMW8
KEGG IDmep:MPQ_1231
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-85, Aligned region: 312..609
MMR_HSR1 [PF01926], Evalue: 0.0071, Aligned region: 197..284
DUF258 [PF03193], Evalue: 0.0073, Aligned region: 195..256
Protein Sequence: 704 a.a.     [Download]
>gi|313200973|ref|YP_004039631.1| type VI secretion protein icmf [Methylovorus sp. MP688]
MQEFFNSPILKSFLAFLAFALVGVAIWFLGPLLAFGEMYPLSSAAMRITVILLLGILVVLTLLEWPKSPV
AVAVLLLSVWHAGPLLSIGHVNPLAPVSVRVTVILVILLLYGIWALYSLWQLMRNDEAFARKMLPNHEGK
HIPAKNEIKAIGQLARKAVSQLKMMHISMAGNTGSFWRTLRRVVEGKRYLYELPWYMIIGNPGAGKTTVL
LNSGLSFPSSEQPEAVSAKQTLANNTGTQHCVWWFTNDAVLIDTSGRYTDQNDGKSAALAASSTTASQVN
IAEKSEETDSDQDDKKKKAQKKKPEEPNFSPQEKNRAEWLGFLGVLRQTRSRAPVNGALLVVDVAELLSS
DSSQRMAHAANLRARLAELRHELGIRFPVYVLLTKSDTLSGFSEYFSSLTSEGRAQVWGFTLPWQETKSG
SFTSRKKSAVSGGQQAPAVSQLLEQELGHLHQRLKDGVALRLQEEFELDRRQALYMLPHEFSALQPPLIE
LLDAVFSDSRFDTTQLTHMLRGVYLTSAMQNMSPDVVADHRALIPRLQKALSNITRKISGKQQPESGMRA
NAVTGMRSYFIADALIRVVFPEAHLVKPNLKWEARLRLLRLVGHALVLMIFFWLTLGLMGSYERNHDYLA
AISTKTDSLAKEVGQLLGKADVSKVNDVLTESRLLPQFHDLDLSDPSIAYLYGLYAAEPIKERADLVYVH
LRVH
 
Nucleotide Sequence: 2115 bp     [Download]
>ref|NC_014733.1|:1241633-1243747 type VI secretion protein icmf [Methylovorus sp. MP688]
ATGCAAGAGTTCTTCAATTCTCCGATCCTGAAGTCATTTCTGGCTTTCTTGGCATTTGCGCTCGTGGGGG
TGGCTATTTGGTTTCTGGGGCCATTGCTCGCCTTTGGGGAAATGTACCCATTGTCTTCTGCTGCCATGCG
GATCACCGTTATTTTGCTGCTGGGCATACTGGTGGTTCTGACTTTATTGGAGTGGCCTAAAAGTCCTGTA
GCTGTTGCTGTATTGCTTTTGAGCGTATGGCATGCCGGGCCTTTGCTTTCTATTGGTCATGTCAACCCTC
TTGCTCCCGTAAGTGTCAGGGTGACAGTCATATTGGTTATCCTGCTTTTGTATGGCATTTGGGCTTTGTA
TTCTCTGTGGCAATTAATGCGCAACGATGAAGCCTTCGCGCGAAAGATGCTACCGAATCACGAGGGTAAG
CATATCCCCGCAAAGAATGAAATAAAAGCCATCGGCCAACTGGCCCGCAAGGCCGTTTCCCAATTAAAAA
TGATGCACATAAGCATGGCGGGAAATACCGGCTCATTCTGGCGCACCTTGCGCAGAGTGGTAGAGGGTAA
GCGTTACCTTTATGAATTACCCTGGTACATGATTATTGGTAATCCTGGTGCAGGCAAGACCACGGTTTTG
CTTAACTCAGGTCTGAGTTTTCCCAGTTCAGAGCAACCGGAGGCTGTTAGTGCAAAACAAACGCTGGCAA
ACAATACTGGCACCCAGCATTGTGTCTGGTGGTTTACCAATGATGCGGTATTGATCGATACATCAGGGCG
CTACACGGATCAGAATGACGGTAAGTCAGCTGCCTTGGCTGCATCTTCAACGACTGCTTCGCAAGTCAAC
ATTGCAGAAAAGTCAGAGGAAACTGATTCTGATCAAGATGATAAGAAAAAAAAGGCGCAAAAGAAAAAAC
CTGAAGAGCCTAATTTTTCACCACAAGAAAAAAACCGGGCAGAGTGGCTGGGATTTCTTGGCGTCTTGCG
ACAAACACGCAGTCGTGCGCCTGTAAATGGTGCTTTATTAGTCGTGGATGTGGCTGAGCTGCTCTCATCG
GATAGCTCACAGCGGATGGCGCATGCCGCCAATCTTCGGGCGAGACTTGCAGAGTTGCGGCATGAGCTGG
GAATACGTTTCCCCGTGTATGTGCTTTTGACAAAATCGGACACGCTTTCAGGGTTCAGTGAGTATTTCAG
TAGTTTGACCAGCGAGGGACGCGCTCAGGTATGGGGGTTCACTTTGCCATGGCAGGAAACAAAGTCCGGT
TCATTTACCTCTCGCAAAAAGAGTGCTGTATCTGGAGGTCAGCAGGCTCCTGCAGTATCGCAGTTGCTGG
AGCAGGAGTTAGGGCATTTGCATCAGCGCCTGAAGGATGGGGTTGCTTTGCGCTTGCAAGAAGAGTTTGA
ATTGGATCGACGTCAGGCGCTTTATATGCTGCCGCATGAATTTTCCGCATTGCAACCACCACTGATTGAA
CTGCTGGACGCGGTGTTTTCTGATTCGCGTTTTGATACTACACAGCTGACGCATATGCTGAGAGGCGTTT
ATCTCACCAGCGCCATGCAGAATATGTCTCCAGATGTTGTGGCAGATCATCGCGCATTAATCCCACGTTT
GCAAAAGGCTCTTTCCAACATAACCCGGAAAATCTCAGGTAAGCAGCAACCTGAGTCAGGCATGCGCGCA
AATGCAGTCACTGGGATGCGTAGCTACTTCATTGCGGATGCCCTGATACGTGTTGTTTTCCCTGAAGCGC
ACTTGGTTAAGCCGAATCTTAAGTGGGAGGCGAGATTACGGCTGCTACGCTTGGTGGGCCATGCACTGGT
CCTGATGATATTTTTCTGGTTAACGCTAGGTTTGATGGGTAGCTATGAGCGTAATCATGACTATCTTGCA
GCTATCAGTACAAAAACGGATTCGCTGGCGAAGGAGGTTGGACAACTGCTTGGTAAGGCAGATGTTTCCA
AAGTAAACGATGTGCTGACCGAGAGCCGGTTGTTACCTCAATTCCATGATCTTGATTTATCCGACCCATC
TATTGCTTACCTTTACGGGCTTTATGCCGCTGAACCAATCAAAGAGCGTGCCGATCTTGTATATGTCCAT
TTGCGAGTGCATTAG
 Primer design