SecReT6
Protein ID: 313200974
SecReT6 ID484
T6SS typeN/A
Gene symbol-
Locus tagMPQ_1232
StrainMethylovorus sp. MP688
Repliconchromosome [GenBank: NC_014733] [Browse all T6SS(s) in this replicon]
Location [Strand]1243879..1244184 [+]
Producttype VI secretion system protein vasd
NoteTssJ
UniProt IDE4QMW9
KEGG IDmep:MPQ_1232
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 8.30E-19, Aligned region: 2..91
Protein Sequence: 101 a.a.     [Download]
>gi|313200974|ref|YP_004039632.1| type VI secretion system protein vasd [Methylovorus sp. MP688]
MDADYFTLDSSDKTLLASDMLAKDEFILKPGESRIIERDSKSQTVAVGVLAGYRELEKVTWRAIYKLKEA
PEQAWYRKLIPSNKAKLNIQMMPQGVILVEQ
 
Nucleotide Sequence: 306 bp     [Download]
>ref|NC_014733.1|:1243879-1244184 type VI secretion system protein vasd [Methylovorus sp. MP688]
ATGGATGCCGATTATTTTACTCTTGATAGCTCCGATAAAACATTACTGGCAAGCGATATGCTTGCCAAAG
ACGAATTCATCTTAAAACCTGGTGAATCAAGAATAATCGAACGAGATAGTAAATCGCAAACAGTCGCTGT
GGGTGTTTTGGCTGGTTATCGCGAACTCGAAAAGGTAACCTGGCGTGCTATTTACAAGCTAAAGGAAGCG
CCAGAACAAGCTTGGTATCGAAAGCTTATTCCATCAAACAAAGCCAAACTAAATATTCAGATGATGCCCC
AAGGCGTCATTCTTGTCGAACAATAG
 Primer design