SecReT6
Protein ID: 313200975
SecReT6 ID484
T6SS typeN/A
Gene symbol-
Locus tagMPQ_1233
StrainMethylovorus sp. MP688
Repliconchromosome [GenBank: NC_014733] [Browse all T6SS(s) in this replicon]
Location [Strand]1244171..1245565 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDE4QMX0
KEGG IDmep:MPQ_1233
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 7.40E-141, Aligned region: 37..464
Protein Sequence: 464 a.a.     [Download]
>gi|313200975|ref|YP_004039633.1| type VI secretion protein [Methylovorus sp. MP688]
MSNNSSLVRGCLSENIIMSWTNKVVWSEGLFLRPQLFQQQERYLETFSHKRCQPLSPFYWGFSHYDIDNE
ALTLGKLVLAKASGIYADGTPFDVPVQTPTPAPLTILQEHLGQTIYLALPIRVPNGEETSFDDMNGSVAR
NSVFDTELTDSNSIGQGPKTVQLGYLRLKLIPQKELTSAWMGLPLARVISLRADGSAELETELIPPINIY
GASEMLTQWLVQLHGTTRQRAEQLAQRLSGSAGTGATQAAEVSDFLLLQILNCYEPQLAHLLRVKESSPE
HIYTILRSMAGELSTFIHVQTRRPRDLPPYNHIDPYGTFKALVEETRELLNNLLIRSAQSIELIQKPNGM
YLASLDPAEISSFSNIVLAVTANMPAELLAKQFTAHGKLAPADRLPELVHLHLPGIALRVLPVPPRQIPF
NAGYVYFQVDAQGSLWEHMQKHGGIGLHVATRLPDLRMELWGIR
 
Nucleotide Sequence: 1395 bp     [Download]
>ref|NC_014733.1|:1244171-1245565 type VI secretion protein [Methylovorus sp. MP688]
TTGTCGAACAATAGCTCTCTGGTCAGAGGGTGTTTATCAGAAAACATAATCATGTCCTGGACAAACAAAG
TGGTGTGGAGTGAGGGGCTGTTTCTGCGTCCTCAGTTGTTTCAGCAGCAAGAGCGATACCTTGAGACATT
CAGTCATAAACGGTGTCAGCCATTATCACCTTTTTATTGGGGATTCAGTCACTATGATATCGACAATGAA
GCATTGACGTTGGGCAAGCTTGTGCTTGCGAAAGCGAGCGGGATTTATGCTGACGGTACACCATTTGATG
TACCAGTTCAGACACCAACACCAGCTCCTTTGACCATATTGCAGGAGCATTTGGGACAAACTATTTATTT
GGCACTTCCTATCCGTGTTCCAAACGGTGAGGAGACATCGTTTGACGATATGAATGGCTCTGTTGCTCGA
AATTCGGTTTTTGATACGGAGTTGACGGACTCCAACTCAATTGGGCAGGGACCAAAAACTGTACAGTTGG
GCTATTTGCGGCTCAAGCTAATTCCACAGAAGGAGCTTACCAGTGCGTGGATGGGCTTGCCGCTGGCCCG
CGTTATTTCTCTTAGGGCTGATGGTAGCGCCGAATTAGAGACTGAATTAATACCCCCAATTAATATTTAT
GGTGCGAGCGAAATGCTCACGCAATGGCTCGTGCAATTACATGGAACTACCCGGCAGCGGGCTGAACAAC
TTGCGCAGCGGCTTAGCGGGAGTGCGGGAACCGGCGCAACGCAAGCTGCAGAAGTGAGTGACTTTTTGCT
CTTGCAAATTCTCAATTGCTATGAACCCCAATTAGCCCATTTGCTCAGGGTAAAAGAAAGTTCTCCAGAG
CATATATATACAATACTGCGTAGCATGGCTGGCGAATTGTCAACGTTCATACACGTACAAACCCGTCGTC
CACGGGATTTGCCCCCGTATAACCATATTGATCCTTATGGCACATTCAAGGCGCTTGTCGAAGAAACGCG
GGAGTTGCTGAATAATCTGCTTATCAGAAGCGCCCAAAGTATTGAGCTGATACAAAAGCCAAATGGAATG
TATCTAGCCAGTCTGGATCCTGCCGAAATTTCAAGTTTCAGCAATATTGTGTTAGCAGTGACTGCCAATA
TGCCCGCAGAGTTGCTGGCTAAGCAATTTACTGCGCATGGAAAGCTTGCTCCTGCCGATCGACTGCCGGA
GCTGGTTCATTTGCATCTCCCAGGGATCGCATTGCGAGTACTCCCTGTACCTCCGCGTCAAATACCGTTC
AATGCAGGATATGTCTATTTTCAGGTAGATGCACAAGGATCGCTTTGGGAGCACATGCAAAAACATGGTG
GTATTGGATTGCATGTTGCAACCCGTTTACCTGACTTGCGGATGGAATTGTGGGGGATACGGTAA
 Primer design