SecReT6
Protein ID: 313200976
SecReT6 ID484
T6SS typeN/A
Gene symbol-
Locus tagMPQ_1234
StrainMethylovorus sp. MP688
Repliconchromosome [GenBank: NC_014733] [Browse all T6SS(s) in this replicon]
Location [Strand]1245550..1246419 [+]
Productpaar repeat-containing protein
NotePAAR
UniProt IDE4QMX1
KEGG IDmep:MPQ_1234
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 6.30E-23, Aligned region: 13..90
Phage_lysozyme [PF00959], Evalue: 2.60E-05, Aligned region: 177..256
Protein Sequence: 289 a.a.     [Download]
>gi|313200976|ref|YP_004039634.1| paar repeat-containing protein [Methylovorus sp. MP688]
MGDTVMSRRFIVVGDPTDHDGKVISGSPTHTISGKPVARLGDKVDCPKKYPDGSPHGVNAIVEGEPNCLI
DGVPAALEGHKSECGCRLLATVSAFYGGEGGTLDSKIMNVKKEKISSSTLKANRLNEDKESLKDPNVKAF
LDAISEAEGGDYYFKYGAIKGKVNDKWRFTDDSTHPGAGFDGKTTAAGRYQINYATWEDMGGRVGLSNFS
PETQDVIAVEILRSIKVIDSIKKGDLDTALSAASKRWSALPQGKNLPGRFKGQPYMSYENFSEIFNQRVD
FYKKNNTRE
 
Nucleotide Sequence: 870 bp     [Download]
>ref|NC_014733.1|:1245550-1246419 paar repeat-containing protein [Methylovorus sp. MP688]
GTGGGGGATACGGTAATGTCGCGCAGGTTTATTGTGGTGGGGGATCCAACAGATCATGATGGCAAGGTGA
TCAGTGGCTCGCCAACGCACACCATCTCCGGAAAACCGGTGGCAAGGCTAGGGGATAAAGTGGATTGCCC
TAAAAAATATCCCGATGGGTCTCCTCACGGCGTTAATGCTATTGTCGAAGGGGAGCCGAACTGTTTGATT
GATGGGGTCCCGGCGGCACTGGAGGGCCATAAGTCAGAATGCGGATGTCGTCTTCTGGCTACCGTCAGTG
CTTTCTATGGAGGTGAAGGTGGCACTCTTGATTCAAAAATTATGAATGTAAAAAAAGAGAAAATTTCCTC
ATCCACATTAAAAGCCAATAGGTTAAACGAAGACAAAGAGTCATTGAAAGATCCTAATGTCAAAGCGTTT
CTTGACGCAATTTCCGAAGCCGAAGGTGGGGATTATTATTTTAAATATGGCGCAATAAAAGGTAAGGTGA
ATGATAAATGGAGGTTCACAGATGACTCAACTCATCCAGGAGCTGGATTTGATGGAAAAACCACAGCAGC
AGGGCGTTATCAGATTAACTATGCAACATGGGAAGATATGGGTGGTAGAGTTGGCTTGAGTAATTTTTCC
CCGGAGACCCAAGATGTTATTGCTGTCGAGATTCTTCGATCAATAAAAGTGATAGACTCGATAAAAAAAG
GTGATTTGGACACTGCATTATCAGCTGCTTCTAAACGATGGTCTGCTTTGCCACAAGGAAAAAATTTACC
TGGAAGATTTAAAGGACAACCTTACATGTCCTATGAGAATTTTTCTGAAATATTTAACCAAAGAGTGGAT
TTTTATAAAAAAAACAATACAAGAGAGTAA
 Primer design