SecReT6
Protein ID: 315123151
SecReT6 ID414
T6SS typei5
Gene symbol-
Locus tagPSM_B0208
StrainPseudoalteromonas sp. SM9913
Repliconchromosome II [GenBank: NC_014800] [Browse all T6SS(s) in this replicon]
Location [Strand]231615..235004 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDE6RQP4
KEGG IDpsm:PSM_B0208
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.20E-85, Aligned region: 45..73
ImcF-related_N [PF14331], Evalue: 2.20E-85, Aligned region: 155..407
ImcF-related_N [PF14331], Evalue: 2.20E-85, Aligned region: 714..743
IcmF-related [PF06761], Evalue: 3.10E-73, Aligned region: 457..759
DUF1215 [PF06744], Evalue: 2.60E-34, Aligned region: 269..303
DUF1215 [PF06744], Evalue: 2.60E-34, Aligned region: 870..988
Protein Sequence: 1129 a.a.     [Download]
>gi|315123151|ref|YP_004065157.1| ImcF domain-containing protein [Pseudoalteromonas sp. SM9913]
MADYVPLAGVASRLLTILLVLLVFSVTKIYRLMQQNKRDEKMADELIDNNDANSSEVNEEITTLKTRMNE
AIDLLKDVKLFKGKNIYQLPWYIMIGPPGAGKTTVIHNSGLDYPLKDKLGVDLVHGVGGTRNCDWWFTNK
AVLIDTAGRYTTQSSHAKHDSRAWEGFLGLLRKHRPLRPINGVMISMGISELMSQTKTERNLHARAIKQR
LQELQNQLGMTFPVYVIFSKVDLIEGFREFFAELTEEECEQVWGITFELDLDKDTQVDAFNKEFHALISK
LTEMLNRRLINERNEAIRAKIFEFPRQLRVLQGVGDDFLKEIFTPNAYEELPMFRGVYLTSATQEGTPSS
FLNDASAGKTDYINQSKSFFIKNVLESVIFPEQNLASTNKHHDKQNKWLRVASISAACVALLGFSVSWYF
SFAWNSNLIDATDEAITTYQELDASSFDRNNLLVLNDRLNALRNLPATNSELINPEDASSVGFNKLTEIK
ESSTNAYKRSLQTYLEPFVANTLIKEMEAHPEHLSYLYETLKCYLMLFKPEYFESEDIVVWFSAYLDRNL
PGDMNMQTRGELMNHISALLNEGITQTEIDNQAVRVARAELTKLPIAERAYQRLQADFLDSSIPPFRLTD
IISFESAQKFTFRNNGDLTRSIPGLYTFNGFHGIFNIEKGKMLGNLMASSWVYGQEASGTYDISKAEIEK
KLEQRYFQDYIYYWQSFLDDLSLNQYSSPAEGVNITDVLAGSEAPIKNIINAVKKNVQLTKLPVSENQKV
AGDVAANAAKVAMQTKANRIKRFLPDEAPKFEIDLPGYQVEEAFEDIIDIDVQQLDNIQKNLRELNIYLT
KLDRGDQLKYSIKDQISGKSKPSFIRQLEYQSSDLPYPFNSWLLDISRDTSNITKNSANRHLNEIWKSKV
LREYNAAIVGRYPFAPQAEKEVSIKDFTRFFGPNGTIDNFFNSYVAPSVDMSSTPWKFEKDIGISNNTLK
MFEHAYKIQTAFFDRGSNTPRIEFGLRTFKLDKTVSSFMIEIDGQSMIYRHGPLKVTNFVWPGASGQSKT
RVVFTPPNGGRSINTTYQGEWSLYRMLDELSEKRSKTREDLELHFSLMGNNAKVELLPSSIRHPFWNSSV
EKFSCPTRL
 
Nucleotide Sequence: 3390 bp     [Download]
>gi|315122943|ref|NC_014800.1|:231615-235004 Pseudoalteromonas sp. SM9913 chromosome II, complete sequence
GTGGCAGACTATGTACCGCTTGCAGGTGTAGCATCACGATTATTAACTATTTTATTGGTATTATTAGTTT
TTTCAGTGACCAAAATTTATCGTCTTATGCAGCAAAATAAGCGCGATGAAAAAATGGCAGATGAGTTAAT
TGATAACAATGATGCCAATAGTAGTGAAGTAAACGAAGAAATTACTACTCTTAAAACGAGAATGAATGAA
GCTATAGATCTACTAAAAGATGTAAAGCTATTTAAAGGTAAAAATATATACCAGTTACCTTGGTATATTA
TGATTGGCCCTCCGGGTGCAGGTAAAACAACGGTTATTCATAACTCAGGCCTCGATTATCCATTAAAAGA
TAAGCTAGGCGTTGACTTAGTTCATGGTGTAGGCGGTACCCGTAATTGTGACTGGTGGTTTACCAATAAA
GCGGTATTAATTGATACCGCAGGGCGTTACACAACACAAAGTAGCCACGCAAAACATGACTCAAGAGCAT
GGGAAGGTTTTTTAGGGTTATTAAGAAAGCATCGCCCGTTACGCCCTATTAATGGCGTGATGATCAGCAT
GGGTATTTCTGAGCTAATGAGCCAGACCAAAACTGAGCGAAACCTACATGCTCGTGCTATAAAACAGCGT
CTTCAAGAATTACAAAACCAACTAGGGATGACATTTCCTGTTTATGTTATTTTTTCTAAAGTTGATTTAA
TTGAAGGCTTTAGAGAGTTTTTTGCTGAGCTAACTGAAGAAGAATGTGAGCAGGTTTGGGGAATTACCTT
TGAACTTGATTTAGATAAAGATACTCAGGTAGATGCGTTCAATAAAGAGTTCCATGCTTTAATTTCTAAG
CTTACGGAGATGTTAAATCGTCGGCTTATTAACGAGCGTAACGAAGCTATCCGTGCCAAAATTTTTGAAT
TCCCTCGACAGTTACGGGTATTGCAGGGCGTAGGTGATGACTTTTTAAAAGAAATTTTCACCCCCAATGC
CTATGAAGAATTACCCATGTTCAGAGGGGTGTACTTAACCAGTGCGACGCAAGAAGGGACACCGTCAAGC
TTTTTAAATGATGCGAGCGCAGGGAAAACAGATTACATAAATCAATCTAAAAGTTTCTTTATTAAGAATG
TTTTAGAAAGTGTTATTTTTCCTGAGCAAAACTTAGCAAGCACTAACAAACATCATGATAAGCAAAATAA
ATGGCTTCGCGTTGCAAGTATTTCAGCTGCGTGTGTTGCTTTATTAGGTTTTTCAGTTTCGTGGTACTTT
AGTTTTGCATGGAATAGCAACTTAATAGACGCCACCGATGAGGCAATTACTACTTACCAAGAGCTCGATG
CCTCTTCGTTTGATAGAAATAATTTATTGGTGTTGAACGACAGACTAAATGCACTGAGAAATCTACCTGC
TACTAACTCTGAGCTCATTAACCCTGAGGATGCTTCATCAGTTGGTTTTAATAAGTTAACCGAAATTAAA
GAATCTTCTACTAATGCTTACAAGCGTTCTTTACAAACGTATTTAGAGCCATTTGTTGCTAATACTTTAA
TTAAGGAAATGGAAGCGCATCCAGAACACTTAAGCTATTTATATGAAACGCTAAAGTGTTACTTAATGTT
GTTTAAACCTGAATACTTTGAAAGTGAAGATATTGTGGTGTGGTTCAGTGCTTATTTAGACAGAAACTTA
CCCGGTGATATGAATATGCAAACGCGTGGTGAGTTAATGAATCATATTTCAGCTTTACTCAATGAGGGAA
TCACGCAAACCGAAATAGATAACCAAGCTGTGCGAGTTGCACGTGCAGAGTTAACTAAACTACCGATTGC
GGAAAGAGCATACCAGCGTCTTCAAGCTGATTTTCTTGATAGTAGTATTCCGCCTTTCAGACTAACCGAT
ATTATTAGCTTTGAAAGTGCACAAAAGTTTACTTTTCGTAATAACGGCGACTTAACGCGAAGCATTCCAG
GGTTATACACTTTTAATGGTTTTCATGGCATTTTTAATATTGAAAAAGGAAAAATGCTTGGCAACTTAAT
GGCTAGTAGCTGGGTTTACGGGCAAGAAGCCTCAGGAACTTACGATATTTCTAAAGCGGAGATAGAGAAG
AAACTAGAGCAGCGCTATTTCCAAGATTACATTTATTATTGGCAGTCATTTTTAGATGACTTGAGTCTTA
ATCAATACAGCTCACCCGCTGAAGGCGTCAATATTACTGATGTGCTAGCAGGCTCTGAAGCACCGATTAA
AAATATCATCAATGCGGTGAAAAAGAATGTTCAGCTTACTAAACTACCAGTATCTGAAAATCAAAAAGTA
GCTGGTGATGTGGCAGCCAATGCCGCTAAAGTCGCTATGCAAACTAAAGCAAATCGAATCAAGCGCTTTT
TACCTGATGAAGCTCCAAAATTTGAAATTGATCTACCAGGTTACCAAGTAGAAGAAGCCTTTGAAGATAT
TATTGATATTGATGTTCAGCAACTTGATAATATTCAGAAAAATTTAAGAGAGTTAAATATTTATTTAACC
AAGCTTGATAGAGGCGATCAGCTTAAGTACTCCATTAAAGATCAAATAAGCGGTAAGAGCAAACCTAGCT
TTATTCGCCAATTAGAGTATCAAAGCAGCGACTTACCTTATCCATTTAATAGTTGGTTACTGGATATTAG
TAGAGATACTAGCAACATAACCAAAAATAGTGCTAACAGGCATCTAAATGAAATTTGGAAAAGTAAAGTT
TTACGCGAGTATAACGCGGCGATTGTGGGCCGTTACCCATTTGCTCCGCAGGCTGAAAAAGAAGTCAGCA
TTAAAGACTTTACCCGCTTCTTTGGTCCTAATGGCACCATAGACAACTTTTTCAATAGCTACGTAGCCCC
GAGTGTGGACATGAGTTCAACCCCTTGGAAGTTTGAAAAAGATATTGGTATTAGCAACAACACGTTAAAA
ATGTTCGAGCATGCTTACAAAATTCAAACCGCATTTTTTGACCGTGGTAGTAATACTCCAAGAATTGAGT
TTGGCTTGCGTACCTTTAAATTAGATAAAACGGTCTCAAGCTTCATGATTGAAATTGATGGCCAATCTAT
GATTTATCGTCATGGTCCGCTTAAGGTGACCAATTTTGTTTGGCCTGGTGCAAGTGGTCAAAGCAAAACT
CGAGTGGTGTTTACTCCACCAAATGGTGGGCGTTCAATTAACACCACCTACCAAGGTGAGTGGTCACTAT
ACAGAATGTTAGATGAACTGAGTGAAAAGCGAAGTAAAACGCGAGAAGACTTAGAGCTGCATTTCTCACT
AATGGGTAACAATGCAAAAGTAGAATTATTGCCGAGTTCAATCAGGCATCCTTTTTGGAATAGCAGTGTA
GAGAAGTTCTCATGTCCGACCCGATTGTAG
 Primer design