SecReT6
Protein ID: 317048730
SecReT6 ID501
T6SS typei3
Gene symbol-
Locus tagPat9b_2521
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]2749312..2752938 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDE6WEV9
KEGG IDpao:Pat9b_2521
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.10E-96, Aligned region: 208..486
ImcF-related_N [PF14331], Evalue: 1.10E-96, Aligned region: 767..814
IcmF-related [PF06761], Evalue: 3.00E-83, Aligned region: 535..838
DUF1215 [PF06744], Evalue: 8.80E-31, Aligned region: 950..1075
Protein Sequence: 1208 a.a.     [Download]
>gi|317048730|ref|YP_004116378.1| type VI secretion protein IcmF [Pantoea sp. At-9b]
MLNLLFAVLTSRLAWGFVGITALSFIIWVIGPVFSIVDSRPLEPEQNRVISIALLYLVWGLSQAIPRLYN
MWLNRKLMSSLETTPTGEPEQDRKRLTNEEQVLASRFGEATEMLKKAHFQRHNSKGTPFWAQRFSRQYLY
QLPWYMIIGAPGAGKTTALVNSGLQFPLADKFGKAALRGIGGTRNCDWWFTNDAVLLDTAGRYTTQESQQ
ERDASEWHHFLALLCKYRGRQPINGVIVTLSVADLLSQTPEALRNQALALRQRLMELHDRLGIRFPVYVL
VTKADLLKGFRSYFAGLDKTQREQIWGFTFPWAQASTADFELSSQFQQEYSLLQQRLDAGLADTLLTESD
AQARAESYLFPQEFAALRPLLAEALDTLFARSDFETQFAPRGIYFASGTQEGLPFDRVMGELTRALHLPG
QQDGESGRWDQVGKDAPIPPTKGQSFFLKDMLEDVVFQESGLAASNRWWELRNRAGLWSGYLALLVIVVI
AGALWLTSYSKNKAYLQEMAAKTPQVEQLGEQLQRQGSGDLFALVPYLNTLLHLPESKDFSLQDPPLTHR
MWLYRGTEVSDASQALYNKALKQLLLPQVAQNITRWLRNDNGSDADYSYEALKAYQMLYQPKHYDGKFLQ
AWLMLNISRELPQNVTQQEVQQLAWHLQQLLETQIQSSPYAQDDALVKREQALINQMPLSQRVYGRLKRL
LQRDGSLPTVTLAALGGPQSELVFSRKSGKSVNDGVPGLYTPDGYWQHVDKQIAPVTQALYQDDRWVLGG
TTQQENSQQTDLAVRQLYMQDYIRQWEQFLSDIQLNNSADLAQRINTARLLSGNHSPLRQLVINLSKVLT
LTRASTDDKAAQTAPPASDNSATRTLQALFSAPKANAAQSDANPAPEQVVGAHFASIIELAQPLQQGSKV
LAVDDFLHQIDDLYRYLTAVQDAANSGMPPPSSDAISRVQASAGRLPGTLQNMVSSMAVGASSDAQRRDM
DNVRKRIQMEVGSFCQQAIAGRYPLVRTGRNEVTPDDLARMFAPGSGLMDSFFRDNLASKVDTTHAAWRF
TPGIDGKTLPGGEALLRPFQQAQSIRDAFFTNGATTPSFRVTLRTVKMDNDILTLTLDVDGQILRYSHGP
QAVQMVSWPGPGGTSQVRMQLGLTNGTTSTLVTSGPWALNRFFDRARLTPSGGLTREASFNVEGHQVTLS
FTPGSIRNPFQLPAFSCP
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c2752938-2749312 Pantoea sp. At-9b chromosome, complete genome
ATGCTGAATCTGCTTTTTGCCGTACTGACCAGCCGCCTCGCCTGGGGTTTTGTCGGTATCACGGCGCTGT
CATTTATCATCTGGGTGATTGGCCCGGTGTTCTCGATTGTCGATTCGCGGCCGCTCGAACCGGAGCAGAA
TCGCGTGATCAGTATTGCCTTGCTGTATCTGGTGTGGGGGTTGAGCCAGGCGATTCCTCGCCTCTACAAC
ATGTGGCTCAACCGTAAACTGATGTCGAGCCTGGAAACCACCCCGACCGGTGAGCCTGAACAGGATCGTA
AACGCCTGACCAACGAGGAGCAGGTGCTGGCGAGCCGTTTTGGCGAAGCTACGGAGATGCTGAAAAAAGC
GCATTTCCAGCGTCACAACAGCAAAGGTACGCCGTTTTGGGCGCAGCGTTTCAGCCGCCAGTACCTCTAT
CAACTGCCGTGGTACATGATCATCGGCGCACCGGGTGCCGGAAAAACTACCGCGCTGGTCAATTCCGGTC
TGCAATTCCCGCTGGCTGATAAGTTCGGTAAGGCGGCGCTGCGGGGCATTGGGGGTACGCGCAACTGCGA
CTGGTGGTTTACGAATGACGCGGTGCTGCTGGACACCGCCGGGCGCTACACCACCCAGGAAAGCCAACAG
GAGCGCGATGCCAGCGAGTGGCACCATTTTCTGGCGTTGCTTTGCAAATACCGTGGCCGCCAGCCGATCA
ATGGTGTGATCGTCACCCTGAGCGTGGCGGATTTATTAAGTCAGACGCCGGAAGCCTTGCGCAATCAGGC
GCTGGCCTTACGTCAGCGTCTGATGGAACTGCACGACCGTCTCGGTATTCGTTTCCCGGTCTACGTACTG
GTCACCAAGGCGGATTTGTTGAAGGGGTTCCGCAGCTATTTTGCCGGGCTGGATAAAACCCAGCGCGAAC
AAATCTGGGGCTTCACCTTCCCCTGGGCGCAGGCGTCTACGGCAGATTTCGAACTGAGTAGCCAGTTCCA
GCAGGAGTATTCGCTGCTGCAACAACGTCTGGATGCCGGGTTAGCCGATACCTTGCTGACGGAAAGCGAC
GCCCAGGCGCGAGCGGAAAGTTATCTGTTCCCGCAGGAGTTTGCCGCATTACGTCCGTTGCTGGCCGAAG
CACTGGATACCTTATTCGCCCGCTCCGATTTTGAAACCCAGTTCGCCCCGCGCGGCATCTACTTTGCCAG
TGGCACCCAGGAAGGGCTGCCGTTTGACCGCGTGATGGGGGAGTTAACCCGCGCGTTGCATTTGCCGGGA
CAACAGGACGGCGAATCAGGCCGCTGGGATCAGGTGGGGAAAGATGCACCAATCCCGCCGACCAAAGGGC
AAAGCTTTTTCCTGAAAGACATGCTGGAAGATGTGGTATTTCAGGAGTCCGGTCTGGCAGCCAGCAATCG
CTGGTGGGAACTGCGCAATCGCGCGGGATTATGGTCCGGCTATCTGGCGCTGTTGGTCATCGTGGTGATT
GCTGGTGCGTTGTGGCTGACCAGTTACAGTAAAAACAAAGCATATTTGCAGGAGATGGCCGCCAAAACGC
CGCAGGTTGAGCAACTTGGCGAGCAGTTGCAACGGCAGGGCAGCGGCGATTTGTTTGCGCTGGTACCGTA
TCTCAACACGCTGTTGCATCTGCCGGAGAGCAAAGACTTTTCATTGCAGGACCCGCCGCTGACGCATCGT
ATGTGGTTGTACCGTGGCACTGAAGTGAGTGACGCCAGCCAGGCACTGTACAACAAAGCGCTGAAGCAAT
TGTTGCTGCCACAGGTGGCGCAAAACATCACCCGCTGGCTGCGTAATGACAACGGCAGTGATGCGGATTA
CAGCTACGAGGCGCTGAAAGCGTATCAGATGCTGTATCAACCGAAGCATTATGATGGCAAGTTCCTGCAA
GCCTGGCTGATGCTGAATATCTCGCGTGAGCTGCCGCAGAACGTGACCCAGCAGGAAGTCCAACAGCTGG
CGTGGCATCTGCAACAGCTGCTGGAAACGCAAATCCAGTCCTCGCCGTATGCGCAGGATGATGCGCTGGT
AAAGCGCGAGCAGGCGCTGATTAATCAGATGCCGCTATCACAGCGCGTTTACGGACGCCTGAAGCGCCTG
CTACAACGTGATGGCAGCTTACCCACGGTCACCCTCGCCGCGCTCGGCGGTCCACAAAGCGAACTGGTGT
TCTCACGTAAAAGCGGTAAATCGGTCAACGATGGCGTCCCCGGCCTGTATACCCCGGACGGATACTGGCA
GCATGTTGATAAGCAAATTGCGCCGGTGACGCAGGCACTGTACCAGGACGATCGCTGGGTACTGGGCGGC
ACCACGCAGCAGGAAAACAGCCAGCAGACCGACTTAGCGGTGCGCCAGCTTTATATGCAGGATTACATTC
GCCAGTGGGAACAATTCCTCAGCGATATTCAGCTCAATAACAGCGCCGACCTTGCACAGCGCATCAACAC
TGCCCGTCTGCTTTCTGGCAACCACTCACCGTTACGCCAGTTGGTCATCAACCTGAGCAAAGTGCTGACG
CTGACGCGTGCATCAACGGATGACAAAGCGGCACAAACTGCGCCGCCAGCGTCAGACAACAGCGCCACCC
GCACCTTACAGGCGTTATTCAGTGCGCCGAAGGCCAATGCGGCGCAGAGCGACGCTAACCCGGCACCGGA
ACAAGTGGTGGGTGCGCATTTTGCCTCGATCATCGAACTGGCGCAGCCGTTACAACAGGGCAGTAAAGTA
TTGGCGGTGGATGATTTTCTGCACCAGATTGACGATCTCTATCGTTACCTGACGGCGGTGCAGGATGCGG
CCAACAGCGGGATGCCACCGCCATCGAGCGATGCCATCAGCCGCGTACAGGCCAGCGCAGGTCGTTTACC
CGGAACGTTACAAAACATGGTCTCCAGCATGGCGGTGGGGGCCAGTTCGGACGCCCAGCGTCGCGATATG
GATAACGTGCGTAAACGTATCCAGATGGAGGTGGGCAGTTTCTGCCAGCAGGCCATCGCCGGACGTTATC
CGCTGGTGCGCACTGGCCGCAACGAAGTGACACCCGACGATCTGGCGCGCATGTTTGCGCCGGGAAGCGG
TCTGATGGACAGCTTCTTCCGTGACAATCTGGCGAGCAAAGTCGATACCACCCACGCGGCCTGGCGTTTC
ACGCCGGGGATTGATGGCAAAACCTTGCCGGGTGGTGAGGCGTTGCTGCGTCCGTTCCAGCAGGCCCAGT
CAATTCGCGATGCGTTCTTTACCAATGGTGCCACCACGCCATCCTTCCGCGTCACACTGCGCACGGTGAA
AATGGATAACGATATCCTCACCCTGACGCTGGATGTCGATGGACAGATCCTGCGCTACAGCCATGGCCCA
CAGGCGGTACAGATGGTCAGTTGGCCGGGGCCTGGTGGCACCAGCCAGGTGCGTATGCAGCTTGGCTTAA
CCAATGGCACCACCTCCACGCTGGTCACCAGCGGTCCCTGGGCACTGAATCGCTTTTTCGATCGCGCCCG
GCTGACCCCGTCCGGCGGCCTGACGCGCGAAGCCAGCTTTAACGTCGAAGGACATCAGGTCACGCTGTCG
TTTACGCCCGGCAGTATTCGCAACCCGTTCCAGCTTCCCGCTTTTAGCTGCCCCTGA
 Primer design