SecReT6
Protein ID: 317049651
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3453
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3785432..3786475 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDE6WE55
KEGG IDpao:Pat9b_3453
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 4.30E-26, Aligned region: 91..105
DUF3702 [PF12486], Evalue: 4.30E-26, Aligned region: 233..342
ImpA-rel_N [PF06812], Evalue: 5.60E-18, Aligned region: 41..101
ImpA-rel_N [PF06812], Evalue: 5.60E-18, Aligned region: 122..144
ImpA-rel_N [PF06812], Evalue: 5.60E-18, Aligned region: 255..272
Protein Sequence: 347 a.a.     [Download]
>gi|317049651|ref|YP_004117299.1| ImpA domain-containing protein [Pantoea sp. At-9b]
MMSELSPQRIQTGGDPRTFSEYATLRDEIGKLSHPARPDVDWIHVEQLCLALFERNGVELQSAAWYTLAR
THTAGACGLNEGLSILEAIITRQWTALWPQAMQARTDIITTLVRRLQNILRCWTFQREDELSELCRSKKL
LESLRDTLTCNGMSEAGQTGSLYEQVKSAIAHLKEGVVTMPQVIAQQAPEMLTRRVYVIQPEQGVLKPFV
SGACCALLAGAMVLGGFGWLSYEQMQQQAQLAQQRRVKEAIPLERLQSWHQGMTELQHLAEQLNGLDKTR
GKYLTVSELKSSIFSAMQAFNQHPPVEEQLRRYAEGEGNQSSEQVQTGMLLRQLEYRYRLLREEKGE
 
Nucleotide Sequence: 1044 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3786475-3785432 Pantoea sp. At-9b chromosome, complete genome
ATGATGAGTGAACTTTCTCCCCAACGCATCCAGACTGGTGGCGATCCGCGCACCTTCAGTGAATACGCCA
CGTTGCGTGATGAGATCGGCAAGCTTTCCCACCCCGCCCGGCCTGATGTGGACTGGATACATGTCGAGCA
GCTCTGCCTGGCACTGTTTGAACGGAATGGTGTGGAATTACAGAGCGCCGCTTGGTACACCCTGGCGCGA
ACGCACACCGCAGGCGCATGTGGGTTAAATGAAGGGCTTAGCATTCTGGAGGCGATTATTACACGCCAGT
GGACGGCACTGTGGCCTCAGGCCATGCAGGCGCGCACGGATATCATCACTACGTTAGTCCGTCGGCTGCA
AAATATTCTGCGGTGCTGGACGTTTCAGCGTGAGGACGAGCTATCCGAGTTATGTCGCAGTAAAAAATTA
TTAGAGTCACTGCGAGATACACTGACATGCAATGGCATGAGTGAGGCGGGGCAAACTGGCAGCCTTTACG
AGCAGGTAAAGTCTGCGATCGCGCATCTTAAGGAAGGGGTGGTCACTATGCCGCAGGTTATCGCCCAACA
AGCCCCGGAAATGCTGACCCGGAGAGTTTATGTGATTCAACCAGAGCAGGGAGTATTAAAGCCTTTTGTC
AGTGGTGCCTGTTGCGCATTGCTGGCCGGGGCAATGGTACTGGGCGGCTTTGGCTGGCTGAGCTATGAGC
AGATGCAGCAGCAGGCTCAACTGGCACAACAGCGCAGGGTAAAAGAAGCTATTCCTCTTGAGCGCCTTCA
GAGTTGGCACCAAGGGATGACTGAGTTACAGCACTTGGCCGAACAACTTAATGGCCTGGATAAAACGCGC
GGTAAATATCTGACAGTCAGTGAACTGAAATCGAGCATTTTCTCCGCCATGCAGGCATTTAATCAGCATC
CGCCGGTTGAGGAACAACTGCGACGCTACGCCGAAGGCGAGGGGAATCAGAGCAGTGAACAGGTACAGAC
CGGGATGTTATTGAGGCAGTTGGAGTATCGGTATCGGTTGTTGCGGGAGGAGAAGGGGGAGTGA
 Primer design

Protein ID: 317049656
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3458
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3790283..3791860 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDE6WE60
KEGG IDpao:Pat9b_3458
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.50E-18, Aligned region: 66..126
ImpA-rel_N [PF06812], Evalue: 3.50E-18, Aligned region: 235..252
ImpA-rel_N [PF06812], Evalue: 3.50E-18, Aligned region: 294..308
Protein Sequence: 525 a.a.     [Download]
>gi|317049656|ref|YP_004117304.1| type VI secretion-associated protein [Pantoea sp. At-9b]
MTGIAVLISACGAEDVALRAEAEPRIHAWAGWIAPITDLAPTGQDPTYDDHFQQMLAEVNKLSGVDTALI
IALAEPLLISVSKDIRVITFYLWARLHQQGEQGLAEGLELLAAALQQYGELLHPQRPRSRQGALSWLSSG
RMLNSLALWPAVDVTLIRRICAVLLRVHDLIREEERQALVPLIQALEVRLARSGGADALVPQNSSAPTEA
DKNLTPMLAPISSGRDLLDQVRLLARYLREQPEGWLAAHHLMKSVRWDTLHHLPPLDASGRTRLAPPKPE
HLAHLKRLWLQQRWQELLDLTDSLFAQSVNHVWLDVQWYVWEALSRGNTDSRLATVVEQDLSALLLRLPG
LECLTFSDGTPFADEVTLSWIARQVKNDASYREPVAQSSASGQEGDLLALESEALTIADTEGAEAALCWL
QQRPGVTSQRARWLLRLLMARVCEQLAKHDMALHLLRELDRSAESLTLVHWSPELLFEVRARRLKLLRTR
AARSESDKARLQSEMENLLAGLIALDPAHAAVLCR
 
Nucleotide Sequence: 1578 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3791860-3790283 Pantoea sp. At-9b chromosome, complete genome
ATGACAGGGATTGCGGTGTTAATCAGCGCCTGTGGCGCAGAAGACGTTGCCTTACGGGCAGAAGCAGAGC
CGCGTATCCACGCCTGGGCGGGCTGGATCGCGCCGATCACCGATTTGGCCCCCACCGGGCAAGATCCGAC
GTATGACGACCATTTCCAGCAAATGCTTGCCGAGGTCAACAAACTCTCCGGTGTGGATACGGCGCTCATC
ATTGCGCTGGCCGAGCCGTTGCTGATCTCAGTCAGCAAAGATATTCGTGTGATCACATTTTACCTGTGGG
CGCGGCTTCATCAGCAGGGAGAACAGGGTCTGGCCGAAGGTCTGGAACTGCTGGCCGCCGCATTGCAGCA
ATACGGTGAATTGTTGCATCCGCAGCGGCCTCGTAGCAGGCAGGGTGCATTGAGCTGGCTCAGCAGCGGC
AGAATGCTGAACAGTCTCGCACTGTGGCCGGCAGTAGATGTGACGCTCATCCGGCGCATCTGCGCCGTGC
TGTTGCGGGTACATGACCTGATCCGTGAAGAGGAGCGTCAGGCGCTGGTGCCGCTGATACAGGCCCTGGA
GGTCCGACTGGCGCGCAGCGGCGGTGCGGATGCGCTGGTGCCGCAAAACAGCAGCGCACCGACAGAGGCT
GACAAAAACCTTACGCCAATGTTGGCCCCCATTTCGTCGGGGCGCGATCTGCTTGACCAGGTCAGGCTTC
TGGCACGTTATCTGCGTGAACAGCCCGAGGGATGGCTTGCCGCGCATCATCTGATGAAAAGTGTACGCTG
GGACACACTTCATCATCTGCCGCCACTGGATGCCAGCGGCCGGACGCGTCTGGCTCCTCCGAAACCTGAG
CATCTGGCACATCTGAAACGTCTGTGGTTGCAACAACGCTGGCAGGAGCTGCTGGACCTGACCGATTCAC
TCTTCGCGCAAAGCGTCAATCATGTCTGGCTGGATGTGCAATGGTACGTCTGGGAAGCGCTCAGCCGGGG
CAACACCGACTCCCGGCTGGCAACCGTGGTTGAGCAGGATTTGTCGGCGTTGTTATTGCGTTTGCCGGGC
CTGGAGTGTCTGACATTTTCCGATGGCACCCCTTTTGCCGATGAAGTGACGCTGAGCTGGATCGCCCGGC
AGGTGAAAAACGATGCTTCTTATCGCGAACCTGTCGCTCAGTCATCTGCCAGTGGGCAGGAGGGAGACCT
CCTCGCGCTGGAGAGTGAGGCGCTGACCATCGCCGATACGGAGGGCGCGGAAGCCGCACTTTGCTGGCTA
CAGCAGCGGCCCGGCGTCACCAGCCAGCGTGCCCGCTGGCTACTGCGTCTGTTGATGGCGAGGGTATGCG
AACAGCTGGCTAAGCACGACATGGCGCTACATCTGTTGCGTGAATTAGACCGTAGTGCGGAGAGCCTTAC
GCTGGTGCACTGGTCGCCTGAATTGCTGTTTGAAGTCAGGGCCAGACGGCTAAAACTGCTCAGAACCCGG
GCAGCTCGCAGCGAGAGTGACAAAGCCCGGTTGCAATCCGAGATGGAGAACTTGCTGGCCGGGCTGATTG
CCCTTGATCCGGCGCACGCCGCAGTACTTTGCCGCTGA
 Primer design