SecReT6
Protein ID: 317049652
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3454
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3786513..3786953 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDE6WE56
KEGG IDpao:Pat9b_3454
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 4.10E-16, Aligned region: 27..113
Protein Sequence: 146 a.a.     [Download]
>gi|317049652|ref|YP_004117300.1| type VI secretion system lysozyme-like protein [Pantoea sp. At-9b]
MSQPSLYELLKGGFSGGLALHQVSEQNQVILSVLDNMQRILNTRAGSLAHIPDYGLPDMTQILAGMPATA
QQLVFTFVQVLLKYEPRLAKIDVVVLESSQPGDLRYVIEAEMKLVGLVRFGTVFMPEGRVLIQHLQQQQF
LENKPV
 
Nucleotide Sequence: 441 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3786953-3786513 Pantoea sp. At-9b chromosome, complete genome
ATGAGCCAGCCTTCGCTCTATGAATTGCTGAAAGGGGGATTTAGTGGTGGTCTGGCGTTGCATCAGGTCA
GCGAGCAGAACCAGGTCATATTGTCCGTACTGGACAATATGCAACGCATTCTGAATACCCGTGCGGGATC
ACTGGCGCATATTCCTGATTATGGCCTGCCAGATATGACGCAAATTTTGGCGGGGATGCCCGCCACAGCC
CAGCAGTTGGTTTTCACCTTCGTGCAGGTATTGCTGAAATATGAGCCGCGACTGGCAAAAATCGACGTTG
TGGTGTTGGAGTCAAGCCAGCCTGGCGACCTGCGCTATGTTATTGAAGCCGAGATGAAACTGGTCGGGCT
GGTGCGATTTGGCACAGTATTTATGCCGGAAGGGCGCGTGCTGATCCAGCATCTGCAACAACAGCAGTTT
CTCGAAAACAAGCCTGTGTAA
 Primer design