SecReT6
Protein ID: 317049653
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3455
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3786950..3787486 [-]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDE6WE57
KEGG IDpao:Pat9b_3455
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.00E-34, Aligned region: 16..168
Protein Sequence: 178 a.a.     [Download]
>gi|317049653|ref|YP_004117301.1| type VI secretion lipoprotein [Pantoea sp. At-9b]
MSPTILPNLVLCTVVLSLSACGLQQKVVDSTSSAFNSIFYKQIKTLHLDFSARESLNSDSREHHPLSEPV
MVRIYQLKARKTFDGTVYQQLIDEAAEVLHADLLAERELIMTPGGDLALNMPMEPETRFVAVVGLFQYPD
MAKNSWRLVLERNELNPDKPRVIELDSRHLMLRAEKPS
 
Nucleotide Sequence: 537 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3787486-3786950 Pantoea sp. At-9b chromosome, complete genome
GTGTCGCCTACCATTTTACCTAACCTGGTGCTGTGCACCGTGGTGTTGAGCCTCTCTGCCTGTGGGTTAC
AGCAGAAAGTTGTTGATAGCACATCTTCCGCGTTTAACTCTATATTTTACAAACAGATAAAGACCCTGCA
TCTCGACTTTTCTGCCCGAGAAAGCCTCAACAGCGATAGCCGTGAACACCATCCGCTTTCTGAGCCAGTT
ATGGTGCGAATTTACCAGTTAAAAGCGCGGAAAACCTTTGATGGCACGGTGTATCAGCAACTGATAGATG
AGGCTGCAGAGGTATTGCATGCAGACCTGTTGGCTGAGCGTGAGCTTATTATGACGCCCGGCGGGGATCT
CGCGCTGAATATGCCGATGGAACCAGAGACCCGATTTGTCGCTGTTGTTGGCCTGTTTCAGTATCCCGAT
ATGGCAAAAAATAGCTGGCGGCTGGTGCTGGAACGCAACGAGCTTAACCCGGATAAGCCGAGGGTGATTG
AGCTGGATAGTCGGCATCTGATGCTGCGTGCGGAGAAGCCATCATGA
 Primer design