SecReT6
Protein ID: 317049654
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3456
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3787464..3788534 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDE6WE58
KEGG IDpao:Pat9b_3456
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.20E-78, Aligned region: 19..315
Protein Sequence: 356 a.a.     [Download]
>gi|317049654|ref|YP_004117302.1| type VI secretion protein [Pantoea sp. At-9b]
MGREAQPSHPRMTQWLESELNRLNFYRFCQLVEHQHRDAPPLGSTSHPGDDPIRLLPHAGMGFPASELKA
LEYGEGPPVVRTTFLGLYGVDAPLPGRYLDDIAQHSEGHEALQGFLDIFNHRVLTQFYRIWRKYSYPATF
EEGGTDSTSQSLLGLIGLGIPGTGKHIATPISRFLALLSVMRQPGRTAEGIAALVRLLAPQTSVQVQPHC
LRPVPVSDPPILTEQGCLLDGNLPLGDEVMDASSQILIDLQTECADEARGWLPEGLLYQDLQVMLRVYLG
WRYTARIRLTLHTGLLAPPALGTTPFWLGMTGVLGVEGECCPADIPATFTTELGSYTGMEPATPSQGNRR
VAYHFT
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3788534-3787464 Pantoea sp. At-9b chromosome, complete genome
ATGGGAAGAGAAGCACAACCGTCGCATCCCAGGATGACACAATGGCTTGAGAGCGAACTGAACCGCCTGA
ATTTTTATCGCTTTTGTCAATTGGTTGAACATCAGCACCGTGACGCTCCGCCACTCGGCAGTACCAGCCA
TCCAGGCGATGATCCCATTCGCCTGTTGCCCCATGCTGGCATGGGTTTTCCTGCCAGCGAACTGAAGGCT
CTGGAGTATGGCGAAGGACCACCGGTGGTGCGGACTACCTTTCTCGGACTGTATGGCGTAGATGCACCGT
TGCCAGGGCGCTACCTCGATGACATCGCGCAGCACAGTGAAGGACACGAAGCGTTGCAGGGATTTCTCGA
CATCTTTAACCACCGCGTGCTGACGCAGTTCTACCGAATCTGGCGCAAATATTCTTACCCCGCCACCTTT
GAAGAAGGGGGTACGGACAGTACCTCTCAATCCTTGTTGGGATTGATTGGGTTGGGCATTCCCGGCACCG
GAAAACACATTGCGACGCCGATATCACGCTTTCTGGCGTTGTTGAGTGTTATGCGCCAACCCGGCAGAAC
GGCTGAGGGGATTGCGGCGTTGGTGCGCCTGCTTGCGCCACAGACGTCGGTTCAGGTGCAGCCGCATTGC
CTGCGTCCGGTGCCGGTCAGCGATCCGCCGATCCTCACTGAGCAAGGATGTTTGCTTGATGGCAATCTCC
CGCTGGGCGATGAAGTGATGGATGCCAGCAGCCAGATCCTGATTGATTTACAGACCGAATGTGCAGATGA
AGCGCGGGGTTGGCTGCCTGAGGGGCTATTGTACCAGGACTTGCAGGTGATGCTGCGTGTGTATCTTGGC
TGGCGTTATACCGCACGCATCAGACTCACGTTACATACCGGGCTGCTCGCGCCGCCAGCCCTCGGCACAA
CACCTTTCTGGCTGGGAATGACCGGTGTACTTGGCGTGGAGGGTGAATGCTGTCCTGCCGATATCCCCGC
CACTTTTACCACCGAATTGGGCAGTTACACCGGCATGGAACCCGCCACCCCCTCACAAGGAAACCGACGT
GTCGCCTACCATTTTACCTAA
 Primer design