SecReT6
Protein ID: 317049655
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3457
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3788498..3790252 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDE6WE59
KEGG IDpao:Pat9b_3457
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.80E-179, Aligned region: 6..581
Protein Sequence: 584 a.a.     [Download]
>gi|317049655|ref|YP_004117303.1| type VI secretion protein [Pantoea sp. At-9b]
MENLTLRYYDAEMRYLLEAGEEFARAHPEQAARLNLDKAGARDPFVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYLRTIPSLSVVEFTPDWRLMKEPLRIARGFEVLSRPIGEQGTRCRYTTTRDIELLPLM
LEKVALTSDAQGRSMIRLRFKGGELADWSSMDVSHLSLYLNADAPLACALHEALTMHVANIRLRLPGESD
SRVVAGHFSAQGFDPDDRLWPGSDSSFSGYQLLLEYFTFREKFMTVALHGLEQARLPAVLPWFELEVTLA
RRWEHDFIFSEKHLRLHVVPVINLFTLESDPLTIDGLQTEYLLRPMRVQDGHTEIYSVDEVISSHNCPWV
PFTSFRHKGGMLRHTAPEHYYHTRVRQGPSGLHETWLILGGEAFDNQSVPHDESLSVSVTGTNGQLPRRA
LQSTLLDQVVKSTATQVQVRNLCAPTLPCYPPNRDRFHWRVLSHLGSSFLWMMDNADVLRGTLALYDWTH
SEMNRRRLEAIVHVCHHEVSRFEQGYLLRGVQIEITLDSTGFAGSGDICLFGEMLSRFFALYTDIHLFNR
LVLILQPTGERLQWEEKHNRRIPG
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3790252-3788498 Pantoea sp. At-9b chromosome, complete genome
ATGGAAAACTTAACCCTGCGATATTACGACGCTGAAATGCGCTACCTGCTGGAAGCCGGAGAAGAGTTTG
CCCGCGCTCACCCGGAACAGGCAGCGAGGCTTAATCTGGATAAAGCCGGTGCGCGCGATCCTTTTGTCGA
ACGTCTGTTTGAAGGTTTTGCCTTCCTGATGGGACGGCTGCGGGAAAAGCTGGATGATGACTTACCCGAA
TTAACCGAAGGGTTGGTCAGCCTGCTGTGGCCACATTACCTGCGCACCATTCCTTCCTTATCTGTGGTGG
AGTTTACCCCTGACTGGCGCTTGATGAAGGAACCGCTACGTATTGCTCGCGGCTTTGAAGTGTTGTCCCG
CCCGATTGGCGAGCAAGGAACGCGTTGCCGCTATACCACCACCCGCGATATTGAACTGCTGCCGCTGATG
CTGGAAAAGGTTGCTCTCACCAGCGACGCGCAGGGGCGTTCCATGATCCGCCTGCGCTTCAAGGGGGGCG
AGCTGGCTGACTGGAGCAGCATGGATGTCAGTCATCTCTCGCTTTATCTCAACGCCGACGCGCCGCTGGC
TTGTGCTCTGCACGAAGCGCTCACTATGCATGTCGCCAACATCAGACTGCGCCTGCCGGGAGAGAGTGAT
AGCCGGGTGGTGGCGGGGCATTTTAGCGCGCAAGGTTTTGACCCTGATGATCGGCTGTGGCCAGGCAGTG
ATAGCAGCTTTAGCGGCTATCAGTTGCTGTTGGAATATTTCACCTTTCGGGAAAAGTTTATGACGGTGGC
CCTGCACGGGCTGGAGCAGGCCAGGCTCCCGGCGGTGCTGCCATGGTTTGAGCTGGAGGTGACGCTTGCC
AGACGCTGGGAACATGATTTTATCTTTAGCGAAAAGCATTTGCGCTTGCATGTCGTGCCGGTCATCAACC
TTTTTACACTGGAATCTGATCCCTTGACCATCGACGGTTTGCAGACGGAATACCTGCTGCGTCCGATGCG
TGTGCAGGATGGGCATACCGAAATTTATTCGGTGGATGAGGTGATCTCCTCCCATAACTGTCCCTGGGTG
CCGTTCACCAGCTTTCGCCACAAAGGTGGCATGCTGCGTCACACCGCGCCGGAGCATTACTACCATACAC
GGGTACGTCAGGGGCCATCCGGCTTACATGAAACCTGGTTAATCCTCGGCGGCGAAGCGTTTGATAACCA
GAGCGTGCCGCACGACGAAAGCCTGTCGGTTAGCGTAACCGGCACCAACGGGCAATTGCCACGCCGGGCG
TTACAAAGCACGTTACTGGATCAGGTGGTGAAATCCACCGCCACTCAAGTACAGGTACGTAATCTTTGTG
CACCGACGCTGCCCTGTTATCCCCCCAATCGTGACCGCTTCCATTGGCGGGTTCTGAGTCATCTCGGCTC
CAGCTTTCTGTGGATGATGGATAACGCCGACGTGTTGCGTGGCACGTTGGCACTGTATGACTGGACACAC
AGCGAGATGAACCGTCGCAGGCTGGAGGCCATTGTGCACGTTTGCCACCACGAGGTGTCGCGTTTTGAAC
AGGGTTATCTGCTGCGGGGGGTACAGATCGAGATCACCCTCGACAGCACCGGTTTTGCTGGCAGCGGCGA
TATCTGTCTGTTTGGCGAAATGCTCAGCCGCTTTTTTGCGTTGTATACCGATATTCATTTGTTTAACCGC
CTGGTCCTGATTCTGCAACCCACCGGAGAACGCCTGCAATGGGAAGAGAAGCACAACCGTCGCATCCCAG
GATGA
 Primer design