SecReT6
Protein ID: 317049657
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3459
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3791881..3795237 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDE6WE61
KEGG IDpao:Pat9b_3459
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.20E-62, Aligned region: 403..720
DUF1215 [PF06744], Evalue: 4.20E-37, Aligned region: 843..963
Protein Sequence: 1118 a.a.     [Download]
>gi|317049657|ref|YP_004117305.1| ImcF domain-containing protein [Pantoea sp. At-9b]
MNKQEKLTFFSVKITVIFILVATALPVFLGGALMWFYPLERTTEWKALFHLVIGCIAVWLGLLCLFTLGV
TVVSGDIRGVIRSMTKTEQSPTEERQHPMIAALLHHLRARYTRFWRSKVRLLLVTGEDAAIDALVPGLRV
QQWLEGQRTVLIYGGNLRTGADREKLAALRTLRSGRPLDGIVQVLGQDESLTVHHSEASLRVLEGINALL
HWQAPVWLWQLLRSSWPQGGHDPCAVGVTFAAGAAPEDIQQQLDKLQPALRDRGMAQLADNLSHDGLLRL
AQQLAEGGSLLWQRYLTPWLMSPSAVALRGLIFSLPHGTSGEVDPHALPQPSLWQQISRDKVKGRRIGLP
WQQTLAWSLLGLMLLWGTGMLVSFTVNRSQVMAAAQQVRALEKNPEINDAQLIALHRLRNDLGRQQHWLA
QGVPWYQRFGLSHTRELYTALLPRYGVTSHRVIHDAARVALEAKLTRLAESPPDSPLRASLASSGYNQLQ
AWLMMSRPERAVADFFVRTMKAVEPQRDGISTPLWQSLAPDLWAFYAASLSSHPQWAMPPDPTLLAQVRQ
VLLQQMGRRNAESTLYSNLLQAMGRNYADVDLEDMTAGTDPHRLFTSDKVVPGMFTRQAWEGGVQQAIEK
AARERREEIDWVLSDSRSALARDVSPEALQERLTQRYFTDFAASWLNFLNGLRLNPTHNIADVTDQLTLM
SDVRQSPLIALMNTLAWQGQTGQRRDAVASSLLNSAQTLIGRKAQPVIDQQPSAPTGPLDSTFGPLLALL
GRDNGSQLMAADGSLSLQTYLTRITRVRLRLQQVAAAPDPQEMLQALAQTVFQGKSVDLTDTQQYGSLMA
ASLGEEWSGFGQTLFVQPLAQAWETVLQPSAVSLNTQWRRAVVENWRSAFDGRYPFAASTSDASLPMLAE
FIRKDAGRLDSFLTQRLAGVLQKEGSHWVPDPVHSQGLTFNPAFLQAINQLRELADILFTDGTQGISFEL
QGRPVSAVMETHLTIDGQKLRYFNQMAEWQAFRWPGESLKPGTLLSWTTVGSGGRVYGDYAGTWGFIRWL
EQGKRQQLDHSQWMLSFATADKRHLQWVLRTQMRDGPLALLRLRGFTLPDAIFSVDAGLAAQVLARDE
 
Nucleotide Sequence: 3357 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3795237-3791881 Pantoea sp. At-9b chromosome, complete genome
ATGAATAAGCAAGAAAAACTGACTTTTTTCTCCGTAAAGATAACCGTCATATTTATCCTTGTGGCCACCG
CGTTACCGGTGTTTCTGGGCGGAGCGCTGATGTGGTTCTATCCGCTTGAACGCACTACGGAGTGGAAAGC
ACTGTTTCACCTGGTCATAGGTTGCATCGCGGTCTGGCTGGGGTTGCTGTGCCTGTTTACGCTTGGTGTC
ACTGTCGTCAGTGGTGATATTCGTGGTGTCATCAGGTCCATGACCAAAACCGAACAAAGCCCGACAGAAG
AGAGGCAGCACCCGATGATAGCGGCGTTGCTTCACCATTTACGCGCCCGTTACACCCGCTTCTGGCGCAG
TAAAGTCCGTCTGTTACTGGTCACCGGGGAGGATGCAGCCATAGATGCCCTGGTTCCCGGCCTGCGGGTA
CAACAATGGCTGGAAGGCCAGCGAACCGTGCTGATTTATGGCGGCAATCTGCGTACCGGGGCCGATCGGG
AAAAACTGGCTGCTTTACGAACGCTACGGTCTGGCCGACCGTTGGATGGCATCGTGCAGGTGTTGGGACA
GGATGAAAGCTTAACGGTGCACCACAGTGAGGCTTCGCTGCGTGTGCTTGAGGGCATCAACGCTCTCCTG
CACTGGCAGGCACCGGTCTGGCTATGGCAGTTACTTCGCAGCAGCTGGCCGCAGGGAGGGCATGATCCCT
GCGCCGTGGGTGTGACCTTTGCCGCTGGCGCAGCGCCTGAAGATATTCAGCAGCAGCTGGATAAATTGCA
GCCTGCATTACGCGATCGTGGCATGGCGCAGCTGGCAGATAACCTCAGCCATGACGGGTTGCTGCGTCTG
GCTCAGCAACTGGCAGAGGGCGGCAGCCTGCTTTGGCAGCGATATCTGACCCCCTGGCTCATGTCGCCGT
CTGCCGTAGCATTACGCGGTTTGATATTTAGTTTGCCCCACGGCACGTCCGGCGAGGTTGATCCGCATGC
GCTGCCGCAACCCTCTCTCTGGCAGCAGATAAGCCGCGACAAGGTGAAAGGCCGACGTATCGGGTTGCCC
TGGCAGCAGACGCTGGCTTGGTCACTGCTGGGGCTGATGTTGCTGTGGGGGACTGGCATGCTGGTGTCGT
TTACGGTTAACCGCTCGCAGGTGATGGCTGCTGCGCAACAGGTCCGGGCGTTGGAAAAGAACCCGGAAAT
CAATGATGCGCAACTGATTGCCTTACATCGGCTACGTAATGATCTTGGTCGTCAGCAGCACTGGCTGGCG
CAGGGTGTCCCTTGGTATCAACGCTTCGGGCTCAGTCATACCCGTGAACTTTATACCGCGTTGCTCCCCC
GGTATGGCGTGACGAGTCATCGTGTGATTCACGATGCCGCTCGTGTGGCACTTGAGGCGAAGCTCACGCG
GCTGGCAGAATCACCTCCGGACAGTCCGCTGCGTGCGTCGCTGGCATCCTCAGGTTATAACCAACTGCAG
GCCTGGCTGATGATGTCGCGCCCGGAACGGGCCGTGGCGGATTTCTTTGTCCGGACGATGAAAGCGGTGG
AACCGCAACGCGACGGGATCTCCACCCCTCTGTGGCAAAGTCTGGCACCGGATTTATGGGCCTTCTATGC
CGCCTCGTTATCCTCTCACCCCCAATGGGCGATGCCGCCTGATCCGACGCTGCTTGCCCAGGTGCGGCAG
GTTTTACTTCAGCAAATGGGCCGCCGCAATGCGGAGAGTACGCTGTATAGCAACCTGTTACAGGCGATGG
GGCGTAACTATGCGGATGTCGATTTGGAAGATATGACGGCAGGCACCGATCCGCACCGATTGTTCACCAG
CGATAAGGTCGTTCCCGGCATGTTTACCCGTCAGGCATGGGAGGGGGGCGTACAGCAGGCGATTGAGAAA
GCGGCGCGGGAGCGTCGTGAGGAGATCGATTGGGTGCTGAGCGACAGCCGGAGCGCGCTGGCGCGGGATG
TCTCACCCGAGGCGCTACAGGAACGGCTGACACAGCGCTATTTCACCGATTTCGCCGCCAGCTGGCTGAA
CTTCCTCAATGGATTGCGGTTGAACCCGACGCATAACATCGCCGATGTAACCGACCAACTTACCTTAATG
AGTGACGTGCGCCAGTCGCCGTTGATTGCGTTGATGAATACCCTCGCGTGGCAAGGACAGACCGGACAGC
GGCGCGATGCCGTTGCCTCCAGCCTGCTAAATTCGGCGCAAACGTTGATTGGCCGTAAAGCGCAACCGGT
CATTGACCAGCAACCCTCTGCGCCCACCGGGCCGCTGGATAGCACCTTCGGTCCGCTGCTGGCGTTGCTG
GGGCGGGACAATGGATCGCAACTGATGGCCGCGGACGGTTCTCTCAGCCTGCAAACTTACCTGACGCGCA
TCACCCGGGTTCGGCTCAGATTACAGCAGGTGGCGGCGGCACCCGATCCCCAGGAGATGCTCCAGGCACT
GGCTCAGACGGTATTTCAGGGCAAAAGTGTCGACCTGACTGACACCCAACAATATGGCAGCCTGATGGCG
GCCAGCCTGGGGGAAGAGTGGAGTGGTTTTGGCCAGACGCTGTTTGTCCAGCCATTGGCGCAGGCGTGGG
AGACGGTCCTGCAACCCTCGGCGGTCAGCCTGAATACGCAGTGGCGACGTGCGGTGGTGGAAAACTGGCG
TAGCGCGTTTGATGGTCGCTATCCGTTTGCTGCCAGCACCAGCGACGCTTCATTGCCAATGCTGGCGGAG
TTCATCCGTAAGGATGCCGGTCGTCTCGATAGTTTCCTCACCCAGCGTCTCGCGGGGGTGTTGCAAAAAG
AGGGCAGCCACTGGGTGCCAGACCCTGTACACAGTCAGGGTCTGACATTTAATCCGGCCTTCCTGCAAGC
AATCAATCAGTTACGCGAACTGGCGGACATTCTGTTTACCGACGGCACTCAGGGTATCAGCTTCGAATTA
CAGGGACGTCCGGTCTCTGCGGTGATGGAAACACATTTGACGATCGATGGGCAAAAGCTCCGTTACTTCA
ATCAGATGGCCGAATGGCAGGCTTTCCGCTGGCCGGGTGAGAGTTTAAAGCCTGGCACGCTGCTGAGTTG
GACCACGGTGGGCAGCGGAGGCCGTGTGTATGGCGATTATGCGGGCACCTGGGGTTTTATTCGCTGGCTG
GAGCAGGGGAAGCGTCAGCAACTGGATCACAGCCAGTGGATGCTGAGCTTTGCCACGGCCGATAAACGCC
ACCTGCAATGGGTATTACGCACGCAAATGCGCGATGGCCCTTTGGCGTTACTCCGCCTGCGCGGCTTCAC
CTTACCGGATGCGATCTTTAGCGTCGATGCCGGCTTGGCCGCACAGGTGCTGGCGCGAGATGAATAA
 Primer design