SecReT6
Protein ID: 317049658
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3460
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3795292..3797937 [-]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDE6WE62
KEGG IDpao:Pat9b_3460
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.80E-40, Aligned region: 224..243
AAA_2 [PF07724], Evalue: 3.80E-40, Aligned region: 598..763
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 226..358
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 603..728
AAA [PF00004], Evalue: 1.20E-18, Aligned region: 751..768
AAA_5 [PF07728], Evalue: 6.30E-14, Aligned region: 226..251
AAA_5 [PF07728], Evalue: 6.30E-14, Aligned region: 602..723
AAA_16 [PF13191], Evalue: 1.00E-13, Aligned region: 203..246
AAA_16 [PF13191], Evalue: 1.00E-13, Aligned region: 269..304
AAA_16 [PF13191], Evalue: 1.00E-13, Aligned region: 507..518
AAA_16 [PF13191], Evalue: 1.00E-13, Aligned region: 571..645
AAA_16 [PF13191], Evalue: 1.00E-13, Aligned region: 666..697
AAA_16 [PF13191], Evalue: 1.00E-13, Aligned region: 744..780
ClpB_D2-small [PF10431], Evalue: 5.10E-12, Aligned region: 770..839
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 64..96
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 225..322
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 368..394
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 599..696
AAA_22 [PF13401], Evalue: 1.90E-09, Aligned region: 724..754
AAA_19 [PF13245], Evalue: 8.30E-08, Aligned region: 223..258
AAA_19 [PF13245], Evalue: 8.30E-08, Aligned region: 594..628
Clp_N [PF02861], Evalue: 3.10E-07, Aligned region: 23..66
Clp_N [PF02861], Evalue: 3.10E-07, Aligned region: 104..124
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 204..240
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 278..376
Arch_ATPase [PF01637], Evalue: 1.10E-06, Aligned region: 594..643
AAA_17 [PF13207], Evalue: 2.80E-06, Aligned region: 226..328
AAA_17 [PF13207], Evalue: 2.80E-06, Aligned region: 601..637
AAA_25 [PF13481], Evalue: 2.90E-06, Aligned region: 226..250
AAA_25 [PF13481], Evalue: 2.90E-06, Aligned region: 281..323
AAA_25 [PF13481], Evalue: 2.90E-06, Aligned region: 381..442
AAA_25 [PF13481], Evalue: 2.90E-06, Aligned region: 598..622
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 220..268
IstB_IS21 [PF01695], Evalue: 1.20E-05, Aligned region: 602..620
Zeta_toxin [PF06414], Evalue: 3.10E-05, Aligned region: 221..248
Zeta_toxin [PF06414], Evalue: 3.10E-05, Aligned region: 483..509
Zeta_toxin [PF06414], Evalue: 3.10E-05, Aligned region: 599..642
NACHT [PF05729], Evalue: 3.90E-05, Aligned region: 226..321
NACHT [PF05729], Evalue: 3.90E-05, Aligned region: 602..623
NACHT [PF05729], Evalue: 3.90E-05, Aligned region: 726..762
Sigma54_activat [PF00158], Evalue: 4.10E-05, Aligned region: 210..241
Sigma54_activat [PF00158], Evalue: 4.10E-05, Aligned region: 600..720
CCDC155 [PF14662], Evalue: 0.00013, Aligned region: 415..532
DUF815 [PF05673], Evalue: 0.00026, Aligned region: 217..262
DUF815 [PF05673], Evalue: 0.00026, Aligned region: 389..414
DUF815 [PF05673], Evalue: 0.00026, Aligned region: 562..626
AAA_14 [PF13173], Evalue: 0.00027, Aligned region: 226..327
AAA_14 [PF13173], Evalue: 0.00027, Aligned region: 600..692
AAA_33 [PF13671], Evalue: 0.00057, Aligned region: 226..296
AAA_33 [PF13671], Evalue: 0.00057, Aligned region: 601..623
AAA_33 [PF13671], Evalue: 0.00057, Aligned region: 721..776
AAA_29 [PF13555], Evalue: 0.0033, Aligned region: 220..243
AAA_29 [PF13555], Evalue: 0.0033, Aligned region: 598..624
DUF2075 [PF09848], Evalue: 0.005, Aligned region: 228..328
DUF2075 [PF09848], Evalue: 0.005, Aligned region: 378..396
DUF2075 [PF09848], Evalue: 0.005, Aligned region: 601..631
AAA_18 [PF13238], Evalue: 0.0073, Aligned region: 226..248
AAA_18 [PF13238], Evalue: 0.0073, Aligned region: 604..628
RNA_helicase [PF00910], Evalue: 0.0096, Aligned region: 227..247
RNA_helicase [PF00910], Evalue: 0.0096, Aligned region: 603..624
RNA_helicase [PF00910], Evalue: 0.0096, Aligned region: 700..721
Protein Sequence: 881 a.a.     [Download]
>gi|317049658|ref|YP_004117306.1| type VI secretion ATPase, ClpV1 family [Pantoea sp. At-9b]
MEHQSAVLLRHLNPFCARALEGAASLCQSRAHAEITPEHWLLKLLETGEGDLTVIARRYAWDMEAIWQSL
LRYLDTQPRTVRSNPALSARLQHLLKQGWLCASLENESTQIRTLHLLMALADTPTLLECDELWPLLTLGK
TQLERLCPLLEEQSEERVRPLEMFSAAAVSPPSAANSDGHPAVLERFTLDLTARARAGQIDPVFGRDNEI
RQMVDILARRRKNNPILVGEPGVGKTALVEGLALRIVQGNVPDSLKLVSIRTLEPGLLQAGAGVKGEFEQ
RLKNIITAVQRSPHPVLLFIDEAHTLIGAGNPAGSADAANLLKPALARGELRTIAATTWSEYKQYFERDA
ALERRFQRVQIDEPDDETACQMLRGLKSRYAQHHGVYISDEAVRAAVTLSRRYLVGRQLPDKAVDLLDTA
SAQVRMSLDTVPESLTRLRAQIAALEMEQQALLEDCAVGHYDGNNRLAETRQFIRQRHDELAAIEARYQQ
EKALTEQLLACRRDPSREQEIAALHDRLVKIQQTTPLLALDVDARTVAQVVADWTGIPHALLMKDEQNEL
LRLDAVLAQRIVGQDHALHAIAQRLRATKTGLAAENGPQGVFLLVGSSGTGKTETALALADTLYGGPRSL
ITLNLSEYQEAHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVLNLFYQVFDRGFM
RDGEGREIDFRHTVILMTSNLGSDQLMQQLAQQPDASDADLQERLRPLLRDHFQPALLARFQTVIYRPLA
PAAMRTIVAMKLEQVSQRLVRHYGIRTHLEESLYEALTHACLLPDTGARNIDSLLNQQILPVLSQQLLTL
IAAGGKPASLTLGWDEEQGIVLSLQEHSNDVAGELKHQPTV
 
Nucleotide Sequence: 2646 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3797937-3795292 Pantoea sp. At-9b chromosome, complete genome
ATGGAACATCAGTCCGCCGTTCTGCTGCGACATCTCAACCCTTTCTGCGCCCGAGCGCTCGAAGGCGCAG
CTTCTTTATGTCAGAGCCGCGCTCACGCGGAAATCACCCCCGAACATTGGCTGCTGAAGTTGCTGGAAAC
CGGCGAAGGCGATCTGACGGTGATTGCCCGTCGTTATGCGTGGGATATGGAGGCTATCTGGCAATCGTTA
TTGCGCTATCTGGACACACAGCCACGCACCGTGCGCAGCAATCCCGCGCTTTCCGCACGCTTGCAACACT
TGCTAAAACAAGGCTGGCTGTGCGCGTCACTGGAAAATGAAAGCACACAAATTCGGACACTCCATTTGCT
GATGGCGCTGGCGGATACCCCGACGCTGCTGGAGTGTGATGAACTCTGGCCGTTACTGACGCTGGGTAAA
ACGCAACTTGAACGCTTGTGTCCGCTGCTTGAGGAACAGTCTGAAGAACGAGTCAGGCCACTTGAGATGT
TCAGTGCGGCTGCTGTATCGCCACCCTCTGCGGCAAATAGCGATGGCCATCCGGCGGTGCTGGAACGCTT
TACCCTTGATCTCACGGCCCGCGCGCGTGCAGGTCAAATCGACCCGGTTTTTGGCCGTGACAATGAAATT
CGTCAGATGGTGGATATCCTGGCTCGTCGGCGTAAAAACAACCCAATCCTGGTGGGGGAACCCGGCGTGG
GGAAAACTGCGCTGGTGGAAGGCTTGGCGCTGCGTATCGTTCAGGGGAATGTGCCAGACAGCCTGAAGTT
GGTGAGCATTCGCACGCTTGAGCCGGGGCTGCTCCAGGCGGGAGCCGGGGTCAAAGGCGAGTTTGAGCAG
CGACTGAAAAATATTATCACCGCCGTACAGCGCTCACCCCATCCGGTGCTGCTGTTTATTGACGAAGCCC
ATACCCTGATCGGTGCAGGTAATCCGGCGGGCAGTGCCGATGCGGCCAATCTTCTGAAACCGGCACTGGC
GCGAGGTGAACTACGCACCATCGCGGCCACCACCTGGAGTGAATACAAACAATATTTCGAGCGCGATGCT
GCGCTGGAGCGGCGTTTTCAGCGTGTGCAGATCGATGAACCTGACGATGAAACCGCCTGCCAGATGTTAC
GAGGTCTGAAGTCTCGCTATGCACAACACCACGGTGTCTACATTTCCGACGAAGCGGTGCGGGCAGCGGT
CACCCTCTCGCGGCGTTATTTGGTGGGGCGTCAGTTACCGGATAAAGCCGTTGATCTGCTGGACACCGCC
AGTGCGCAGGTCCGAATGAGTCTGGACACCGTACCGGAATCACTCACCCGACTCAGGGCACAGATCGCTG
CTCTGGAAATGGAGCAACAGGCGCTGCTGGAGGATTGTGCGGTCGGCCATTATGACGGCAATAACCGTTT
GGCCGAAACCCGGCAGTTTATCCGACAGCGGCATGATGAGCTTGCGGCAATAGAAGCGCGTTATCAGCAG
GAAAAAGCGCTGACGGAGCAGTTGCTGGCCTGCCGCCGCGACCCTTCACGGGAGCAGGAGATTGCTGCCT
TACACGATCGGCTGGTGAAGATTCAGCAGACGACGCCGCTGCTGGCGCTGGATGTGGACGCACGCACGGT
GGCACAGGTAGTTGCCGACTGGACCGGCATCCCGCACGCCTTATTGATGAAAGATGAGCAGAACGAACTA
CTGAGGCTGGACGCCGTCCTGGCCCAACGGATTGTCGGGCAGGATCACGCGCTGCATGCGATTGCGCAGC
GGCTGCGCGCGACGAAAACCGGTCTCGCTGCGGAAAATGGACCACAGGGGGTATTCCTGCTGGTGGGCAG
CAGCGGCACAGGAAAAACCGAAACTGCGCTGGCGCTGGCAGATACCCTCTACGGCGGGCCACGGTCGCTG
ATTACCCTTAACCTCAGCGAATATCAGGAGGCGCATACCGTCAGTCAGCTCAAAGGTTCACCGCCCGGCT
ACGTCGGCTATGGTCAGGGCGGCATCCTGACGGAAGCCGTGCGTAAACGCCCCTACAGCGTGGTGCTGTT
GGATGAAGTGGAAAAGGCGCACCGCGATGTGTTGAATCTGTTTTATCAGGTGTTTGATCGCGGTTTTATG
CGTGATGGTGAAGGGCGTGAGATCGATTTTCGTCACACCGTTATTCTGATGACCTCCAATCTCGGCAGCG
ACCAACTGATGCAGCAGTTGGCGCAACAACCTGACGCCAGTGATGCTGATTTACAGGAACGACTACGTCC
GTTGCTGCGTGACCATTTCCAGCCCGCGCTGTTGGCACGTTTCCAGACGGTGATATACCGGCCGCTGGCT
CCGGCAGCGATGCGCACCATCGTTGCCATGAAGCTGGAACAGGTTAGCCAACGGCTGGTTCGTCATTATG
GCATCCGTACCCACCTTGAAGAGAGCCTGTATGAGGCGCTCACCCATGCCTGTCTGCTGCCGGATACCGG
TGCCCGCAACATCGATAGCCTGCTGAACCAACAGATTCTCCCGGTGCTGAGCCAACAACTGTTGACGCTG
ATCGCCGCCGGAGGCAAACCCGCAAGCCTGACATTGGGCTGGGATGAGGAGCAGGGCATCGTGCTGTCGT
TGCAGGAGCACAGCAACGATGTGGCAGGTGAGCTAAAGCATCAACCCACGGTTTGA
 Primer design