SecReT6
Protein ID: 317049659
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3461
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3798067..3798567 [-]
Producttype VI secretion system effector
NoteTssD
UniProt IDE6WE63
KEGG IDpao:Pat9b_3461
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.10E-36, Aligned region: 6..146
Protein Sequence: 166 a.a.     [Download]
>gi|317049659|ref|YP_004117307.1| type VI secretion system effector [Pantoea sp. At-9b]
MAIPVYLWLKDDGGMDIKGSVEAEHREGSVEVVAMKHQVHIPTDGNTGKVTGTRVHAPLQFTKAIDSSSP
YLYKAVTTGQTLKSAELKWYLIDSGGNEVEYFNTRLENVKVVKVSPLMHDIKDPAKEQHNHLEEIELRYE
KITWTFKEGNLVHSDEWNTRTVAVAG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3798567-3798067 Pantoea sp. At-9b chromosome, complete genome
ATGGCGATTCCAGTTTATCTGTGGCTGAAAGACGACGGCGGCATGGATATTAAAGGTTCGGTTGAGGCCG
AGCATCGGGAGGGAAGCGTAGAGGTCGTGGCCATGAAACATCAGGTCCACATTCCTACCGATGGGAATAC
CGGCAAGGTGACGGGCACCCGCGTCCATGCCCCTTTGCAGTTTACCAAAGCGATCGACTCCTCCAGTCCG
TATCTCTACAAAGCGGTCACCACCGGCCAGACGCTGAAGAGCGCCGAGCTTAAGTGGTATCTCATTGATA
GCGGAGGTAATGAGGTGGAGTACTTCAATACCCGGCTGGAAAACGTCAAGGTGGTGAAGGTTAGCCCCCT
GATGCATGACATCAAAGATCCCGCCAAAGAGCAGCACAATCATCTGGAAGAGATTGAGCTGCGCTACGAA
AAAATCACCTGGACCTTCAAAGAGGGCAACCTTGTTCATTCTGATGAGTGGAACACGCGAACGGTTGCTG
TCGCTGGCTAA
 Primer design