SecReT6
Protein ID: 317049660
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3462
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3798573..3800159 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDE6WE64, E6WE64
KEGG IDpao:Pat9b_3462
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.00E-17, Aligned region: 398..494
Protein Sequence: 528 a.a.     [Download]
>gi|317049660|ref|YP_004117308.1| OmpA/MotB domain-containing protein [Pantoea sp. At-9b]
MSSVPQRIKRGWAAKHRPHSALSFVRALPEESYRLPVVLYCGDDAQGWPEQEAVRLVPQGCWIHIKASRE
LQHVLRQLLLSRPGWGGQIAICVSVNPQQHTQLAAVENQLHELRWQIAMLRREVQLALPLLLTMRVAGNI
TLTTQPLWQVSVVGAGTQIWYEGQAPQSIEQWLAQADSRVLQQQILFNALDCGFSQRVLGFFTADHPDVA
PVAPHAMLCALQATLTQQQTDSLWQQGLSGCTTLRSVTGWSANHGESVQPDFILPLLPRGRTVSPVRRAV
LPVLTSFLVLVFIALSYSAWNNQVLIHRIAFDLAHYHRIAMVDAGPKAAAVALLREDAAQLNQWARQGEP
FSLGMGLYRGERLHLPVLDAIRSWQPPPSHPLAPQPQATIAQLDSLALFDSGKAELKPGSTKMLIKALVG
IRAKPGWLIVISGHTDNTGDPAFNQQLSLQRAEAVRNWMRDTGAIAESCFAVQGYGVSRPLVTNDTPEGR
ATNRRVDIRLVPQADACLEPDDTLLSSRDGDSNQHLTE
 
Nucleotide Sequence: 1587 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3800159-3798573 Pantoea sp. At-9b chromosome, complete genome
ATGAGCAGCGTGCCGCAGCGCATTAAGAGAGGATGGGCCGCGAAACATCGCCCACATTCCGCCTTATCAT
TCGTCAGGGCGCTGCCCGAAGAGAGTTATCGTCTGCCGGTGGTGTTGTACTGCGGCGATGATGCGCAGGG
CTGGCCGGAGCAGGAAGCCGTCCGGCTGGTGCCACAGGGATGCTGGATACACATCAAAGCCAGTCGCGAG
CTACAACATGTATTACGCCAATTGCTGCTATCGCGTCCTGGCTGGGGAGGCCAGATCGCCATCTGTGTCA
GTGTGAATCCACAGCAACATACGCAGCTGGCGGCAGTGGAAAACCAACTACATGAATTGCGCTGGCAGAT
TGCCATGCTGCGTCGTGAGGTGCAGCTGGCGCTACCGTTGCTGTTAACCATGCGGGTGGCGGGCAACATC
ACACTGACGACACAACCGCTGTGGCAAGTCAGCGTGGTGGGGGCCGGGACACAGATATGGTATGAGGGTC
AGGCACCACAATCTATTGAGCAGTGGTTAGCGCAGGCGGATAGCCGCGTGCTCCAACAGCAGATCCTGTT
CAACGCACTGGATTGTGGCTTCAGTCAGCGTGTGTTGGGCTTTTTTACCGCAGATCACCCGGATGTTGCA
CCGGTTGCCCCTCATGCCATGCTCTGTGCGTTGCAGGCCACGTTGACGCAGCAGCAGACCGATTCGCTGT
GGCAACAAGGGCTATCCGGCTGCACCACTCTGCGGTCGGTCACTGGCTGGTCGGCAAACCATGGAGAGAG
TGTCCAACCCGATTTCATTTTACCCTTGTTGCCGCGCGGGCGGACCGTTAGCCCGGTTCGTCGGGCAGTG
CTGCCAGTGCTGACCTCGTTTCTCGTCCTGGTCTTTATCGCACTGAGTTACAGCGCATGGAATAACCAGG
TGCTCATCCATCGCATCGCGTTTGACCTTGCGCACTATCACCGTATTGCCATGGTCGATGCAGGCCCGAA
AGCTGCCGCCGTTGCGCTACTGCGCGAGGATGCCGCACAGCTAAACCAGTGGGCGCGCCAGGGCGAACCC
TTCTCTCTGGGGATGGGGTTGTATCGTGGCGAACGTTTGCACCTGCCGGTGCTGGATGCCATCCGCAGCT
GGCAGCCTCCTCCTTCACACCCGCTGGCTCCCCAACCACAAGCAACGATTGCGCAGCTCGACAGCCTGGC
GTTGTTCGATTCCGGCAAAGCAGAGCTGAAGCCAGGCTCGACCAAAATGCTGATCAAGGCCCTGGTTGGC
ATTCGGGCAAAACCAGGCTGGCTGATTGTGATTAGCGGGCATACCGACAACACCGGTGACCCGGCATTTA
ATCAGCAGCTCTCGCTGCAACGTGCGGAAGCCGTGCGTAACTGGATGCGCGACACCGGGGCTATTGCTGA
AAGCTGTTTTGCGGTGCAGGGGTACGGTGTGAGCCGCCCGCTTGTCACCAACGATACCCCGGAGGGGCGC
GCAACCAACCGGCGTGTCGACATTCGTCTGGTGCCACAGGCTGATGCCTGTCTGGAGCCGGATGACACCC
TGCTGTCATCACGGGATGGTGACAGTAATCAACACTTAACGGAGTAA
 Primer design