SecReT6
Protein ID: 317049661
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3463
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3800156..3800836 [-]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDE6WE65
KEGG IDpao:Pat9b_3463
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.60E-35, Aligned region: 12..213
Protein Sequence: 226 a.a.     [Download]
>gi|317049661|ref|YP_004117309.1| DotU family type IV/VI secretion system protein [Pantoea sp. At-9b]
MSNNQQGGFVDIDALMQNSWLQVISLRHQPQFKEGEGKALWQRCVADIKQVQQVLRDAGTGDESRQDILL
AHCALLDEAVKGRGVQDDACMQWYHLPLQGHFLHSIDAGETLCDRMWQVLRQPTADALVLMCFHRVMLLG
FLGGYPSLQAAERQELVSALNARVPPYKHTTEQFLLTGTEGSLQRRIVSHWPVRLGLSALLLLAVWWGLD
RWLDQLIVVLLPEVTG
 
Nucleotide Sequence: 681 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3800836-3800156 Pantoea sp. At-9b chromosome, complete genome
ATGAGTAACAACCAACAGGGAGGTTTTGTGGATATCGATGCATTGATGCAGAACAGCTGGCTTCAGGTCA
TTAGCCTACGGCATCAGCCGCAGTTTAAAGAGGGAGAGGGTAAAGCGTTATGGCAGCGTTGCGTGGCCGA
TATTAAGCAGGTACAGCAGGTACTGCGCGATGCGGGCACCGGAGATGAAAGCCGTCAGGACATCCTGCTC
GCACACTGTGCATTGCTTGATGAAGCCGTGAAGGGGCGAGGGGTGCAGGATGACGCCTGTATGCAGTGGT
ATCACCTGCCGCTTCAGGGGCATTTTCTGCATTCCATCGATGCCGGTGAAACCCTGTGCGACCGAATGTG
GCAGGTACTTCGCCAGCCAACTGCGGATGCCTTGGTGTTGATGTGCTTTCATCGGGTGATGTTGCTGGGG
TTCCTTGGTGGCTATCCATCGCTGCAGGCAGCGGAACGCCAGGAGCTGGTCAGCGCGCTTAATGCACGTG
TGCCGCCGTACAAACATACCACCGAACAATTCCTGCTAACCGGAACGGAGGGCAGTTTGCAGCGGCGCAT
CGTAAGTCACTGGCCGGTGCGTCTGGGGTTGTCAGCATTACTGTTGTTGGCAGTGTGGTGGGGGCTGGAT
CGTTGGTTGGATCAACTGATAGTGGTACTGCTACCAGAGGTGACGGGATGA
 Primer design