SecReT6
Protein ID: 317049662
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3464
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3800833..3802173 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDE6WE66
KEGG IDpao:Pat9b_3464
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.10E-131, Aligned region: 18..443
Protein Sequence: 446 a.a.     [Download]
>gi|317049662|ref|YP_004117310.1| type VI secretion protein [Pantoea sp. At-9b]
MKTEQPLWGRGVMISPQHFQQQAAWAEWRSECLAKMGLNHPWGVLQAEFDPEPLRHDRLQPRHLHVRFSD
GTLIDTQNADALPPTLTLSAEHREVEVVLALPQMYANGGNCLQPDQVAERPVRFRQRWRDIRNLFGDDSR
QIAVLHPELTLRYAHQDNSEWLTCPVARLQRDTQGVWTLDQQFLPPILVLSGSNWLLTALEQLLTQLRSR
LTRLMAMRRESNQRMADFAVADVSLFWLLNALNSAEPVLANCLRHPQSAPERLYPELARLAGSLLTFSLE
HQINAIPIYRHDDLNNVFPPLFRLLSRLLEASLPSRVVAIEMSHDQRLRQWLARLNDPRLREEADFYLSV
RSPLPVAQLQEQVPRQCKVGSPDDVMSLVNTSQLGIPLQPLSRVPAAIPLRLENQYFSLDLSHPAARTML
ESGCCMFYVPGTLGDPQLELFAVLRT
 
Nucleotide Sequence: 1341 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3802173-3800833 Pantoea sp. At-9b chromosome, complete genome
ATGAAAACGGAACAACCGCTCTGGGGGCGGGGGGTGATGATCTCGCCCCAGCATTTTCAGCAGCAAGCGG
CATGGGCGGAGTGGCGCAGTGAGTGTCTGGCAAAGATGGGGCTTAATCATCCCTGGGGGGTGCTACAGGC
CGAGTTTGACCCCGAGCCACTGAGGCATGATCGGCTTCAGCCTCGTCATCTGCATGTTCGCTTCAGTGAC
GGGACGCTGATTGATACCCAGAATGCCGATGCACTCCCACCCACACTGACATTGAGCGCTGAGCACCGGG
AAGTCGAGGTGGTTCTGGCGTTGCCACAGATGTATGCCAATGGTGGTAACTGCCTGCAACCTGACCAGGT
GGCGGAACGTCCGGTGCGTTTTCGTCAGCGTTGGCGCGATATCCGTAACCTGTTTGGCGATGACTCACGG
CAGATTGCCGTGCTGCATCCCGAATTGACGCTGCGCTATGCCCATCAGGACAACAGCGAGTGGTTAACCT
GTCCGGTCGCGCGTCTGCAACGGGATACTCAGGGGGTCTGGACGTTGGACCAGCAGTTTCTGCCCCCGAT
ACTGGTGTTGAGCGGAAGCAACTGGTTACTCACCGCGCTGGAACAACTGCTGACGCAATTGCGCTCCCGG
CTGACGCGGTTGATGGCGATGCGTCGTGAAAGCAACCAGCGCATGGCCGATTTTGCCGTTGCAGATGTAT
CACTGTTCTGGTTGTTGAATGCGTTAAACAGCGCTGAACCGGTGTTGGCGAATTGCCTGCGCCATCCACA
AAGCGCGCCTGAGCGGTTATACCCGGAGCTGGCAAGACTGGCCGGGAGTTTGTTGACCTTTTCCCTTGAG
CATCAAATCAACGCCATACCGATCTATCGACATGATGATCTCAACAACGTATTCCCGCCATTGTTTCGTT
TGCTCTCCCGGCTACTGGAAGCCAGCCTGCCCTCGCGTGTCGTGGCAATTGAGATGAGTCATGACCAAAG
GTTGCGTCAGTGGCTGGCTCGCCTCAATGATCCACGTTTGCGTGAAGAGGCTGATTTTTATCTTTCGGTA
CGCTCACCATTACCGGTAGCGCAACTGCAGGAACAGGTGCCACGTCAGTGCAAAGTGGGTAGCCCGGATG
ATGTGATGAGCCTGGTGAATACCTCACAGTTGGGGATTCCACTCCAGCCATTGAGCCGCGTTCCCGCCGC
CATTCCATTACGGCTGGAAAATCAATATTTCTCCCTCGATCTGTCTCACCCGGCGGCACGCACGATGCTG
GAAAGTGGCTGCTGCATGTTTTATGTCCCCGGCACGTTGGGCGATCCGCAACTTGAACTCTTCGCGGTGC
TAAGAACATGA
 Primer design