SecReT6
Protein ID: 317049663
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3465
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3802189..3803730 [-]
Producttype VI secretion protein
NoteTssC
UniProt IDE6WE67
KEGG IDpao:Pat9b_3465
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-171, Aligned region: 88..509
Protein Sequence: 513 a.a.     [Download]
>gi|317049663|ref|YP_004117311.1| type VI secretion protein [Pantoea sp. At-9b]
MSAKNETATGGQATVLERPESARVYASLFEKINLNPVAHLSDVAVWQDSQAMSDASADERVTAAMQVLLE
CLKQSGLKVEKLDKTLLDHHIAQLDQQISRQLDLVMHHPIFQQVESTWRGLKSLVDKADFRQNVKIALLD
LSKEALRQDFEDSPEIIQSGLYLQTYVSEYDTPGGEPIAAIISAWEFDASAQDVALLRNIAKVASSAHMP
FIGSVGPAFFLKENMEEVAAIKDIGNYFDRAEYIKWQAFRESDDARYIGLTMPRVLGRLPYGPDTLPVRS
FNYMEEVKGPDHDKYLWISASFAFATNMVRSFIHNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFASLGFIPLSYYKNRDYACFFSANSTQKPLQFDTADATANSRINARLPYIFLLSRIAHY
LKMIQRENIGTTKDRRLLEMELNAWVRSLVTEMTDPGDDLQASHPLRDARVVVEDIEDNPGFFRVKLFAV
PHFQVEGMDVNLSLVSQMPKAKS
 
Nucleotide Sequence: 1542 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3803730-3802189 Pantoea sp. At-9b chromosome, complete genome
ATGTCTGCAAAGAATGAAACTGCTACTGGCGGTCAGGCGACTGTGCTTGAAAGACCTGAATCGGCCCGTG
TTTACGCCTCCCTGTTTGAAAAAATTAACCTCAATCCGGTAGCGCATCTGAGTGATGTGGCGGTCTGGCA
GGACAGTCAGGCCATGTCTGATGCCAGCGCTGATGAACGCGTTACGGCAGCGATGCAGGTGCTACTGGAG
TGCCTGAAACAGAGCGGCTTAAAAGTGGAGAAACTCGACAAAACGCTGTTGGATCATCATATTGCACAGT
TGGACCAACAAATTAGCCGTCAACTCGATTTGGTGATGCATCACCCTATTTTTCAGCAAGTTGAGTCCAC
CTGGCGTGGTCTGAAATCGCTGGTTGATAAGGCCGATTTTCGCCAAAACGTCAAAATTGCCTTGCTGGAT
CTCTCCAAAGAAGCCTTACGTCAGGATTTTGAAGATTCTCCGGAGATTATTCAGAGCGGCCTCTATCTCC
AGACTTATGTCAGCGAGTATGACACCCCGGGCGGCGAACCCATTGCTGCCATCATCTCTGCCTGGGAGTT
TGATGCTTCGGCACAGGATGTGGCCTTGTTGCGTAATATTGCGAAGGTCGCTTCATCGGCGCACATGCCG
TTTATCGGGTCTGTCGGCCCGGCCTTCTTCCTGAAAGAGAACATGGAAGAGGTGGCTGCCATCAAGGATA
TTGGCAACTACTTCGACCGGGCCGAGTACATCAAGTGGCAAGCCTTCCGCGAAAGCGATGATGCGCGTTA
CATCGGCCTGACCATGCCCCGTGTGCTGGGACGCCTGCCGTATGGCCCGGATACCCTGCCGGTGCGGAGC
TTCAACTACATGGAGGAGGTGAAAGGCCCGGATCACGACAAGTACCTGTGGATCAGTGCCTCTTTTGCCT
TTGCCACCAATATGGTACGCAGTTTTATCCACAACGGCTGGTGCGTACAAATCCGTGGTCCCCAAGCTGG
CGGTGCGGTGCAGGATCTGCCAATCCATCTCTATGATCTTGGCACCGGCAATCAGGTAAAAATTCCTTCT
GAAGTGATGATCCCGGAAACCCGCGAATTCGAGTTTGCCAGTCTTGGCTTTATCCCGCTGAGTTACTACA
AAAATCGCGATTATGCCTGCTTTTTCTCGGCGAATTCGACGCAAAAGCCCCTTCAGTTTGACACTGCTGA
TGCCACGGCTAACAGCCGTATCAACGCTCGTCTGCCTTATATATTTTTGCTATCGCGTATTGCGCACTAC
CTGAAGATGATTCAGCGCGAAAATATCGGCACCACCAAGGATCGGCGTTTGCTGGAGATGGAGTTGAACG
CCTGGGTACGCAGCCTGGTCACCGAGATGACCGATCCCGGCGACGATCTTCAGGCCTCACATCCACTGCG
GGATGCCAGGGTGGTGGTGGAGGACATTGAGGATAACCCCGGGTTTTTCCGCGTGAAGTTGTTCGCTGTG
CCGCATTTCCAGGTGGAAGGTATGGATGTCAACCTGTCGCTGGTTTCACAGATGCCAAAAGCGAAATCGT
AA
 Primer design