SecReT6
Protein ID: 317049664
SecReT6 ID502
T6SS typei2
Gene symbol-
Locus tagPat9b_3466
StrainPantoea sp. At-9b
Repliconchromosome [GenBank: NC_014837] [Browse all T6SS(s) in this replicon]
Location [Strand]3803769..3804266 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDE6WE68
KEGG IDpao:Pat9b_3466
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.60E-50, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|317049664|ref|YP_004117312.1| type VI secretion protein [Pantoea sp. At-9b]
MSNSYQNEIPKARVNIKLDLHTGGSLKKVELPLKLLVTGDFSHGKETRLLSEREKTEVNKHNFNQVLAEY
SPAINLNVPDTLAADGSEQWLNLTFREIKDFEPEQVARQIPQLKAMLAMRNLLRDLKSNLLDNVTFRKEF
EAILKDPALSDALRTELTSLVPEKA
 
Nucleotide Sequence: 498 bp     [Download]
>gi|317046238|ref|NC_014837.1|:c3804266-3803769 Pantoea sp. At-9b chromosome, complete genome
ATGAGCAATTCTTATCAAAATGAGATTCCGAAAGCCCGTGTCAATATTAAGCTCGACCTGCATACGGGAG
GAAGTCTGAAGAAGGTTGAGTTGCCGCTCAAGTTATTGGTTACGGGGGATTTTAGTCACGGTAAGGAGAC
TCGCCTGCTCTCGGAGCGAGAAAAAACCGAGGTTAACAAACACAATTTCAACCAAGTGCTGGCGGAATAT
TCGCCTGCTATCAATTTGAATGTCCCGGACACCCTGGCTGCTGACGGCAGTGAACAGTGGTTAAATCTGA
CCTTCCGGGAGATCAAGGATTTTGAACCGGAACAGGTTGCCCGCCAAATACCGCAACTGAAAGCGATGCT
CGCCATGCGCAATTTATTGCGCGACCTTAAATCCAATCTGCTTGATAACGTGACCTTCCGCAAAGAGTTC
GAAGCCATCCTGAAAGATCCCGCGCTGAGCGATGCCTTGCGCACTGAACTGACCTCCCTGGTGCCGGAAA
AAGCCTGA
 Primer design