SecReT6
Protein ID: 319778086
SecReT6 ID416
T6SS typei3
Gene symbol-
Locus tagMesci_6366
StrainMesorhizobium ciceri biovar biserrulae WSM1271
Repliconplasmid pMESCI01 [GenBank: NC_014918] [Browse all T6SS(s) in this replicon]
Location [Strand]306693..310256 [-]
Producttype VI secretion protein icmf
NoteTssM
UniProt IDE8TPV7, E8TPV7
KEGG IDmci:Mesci_6366
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.90E-86, Aligned region: 179..437
ImcF-related_N [PF14331], Evalue: 2.90E-86, Aligned region: 901..939
IcmF-related [PF06761], Evalue: 2.10E-73, Aligned region: 491..802
DUF1215 [PF06744], Evalue: 2.40E-33, Aligned region: 288..317
DUF1215 [PF06744], Evalue: 2.40E-33, Aligned region: 924..1048
AAA_33 [PF13671], Evalue: 0.0086, Aligned region: 117..129
AAA_33 [PF13671], Evalue: 0.0086, Aligned region: 392..478
AAA_33 [PF13671], Evalue: 0.0086, Aligned region: 936..972
AAA_19 [PF13245], Evalue: 0.0089, Aligned region: 116..132
Protein Sequence: 1187 a.a.     [Download]
>gi|319778086|ref|YP_004134516.1| type VI secretion protein icmf [Mesorhizobium ciceri biovar biserrulae WSM1271]
MTRWLLRIFSMTALIGFATAIWFAGPLIRFADSRPLGPAWLRATIIGVIVATLALFHGLRFWQGRKAQKA
LETVVAHNDDRDDDDGRLLEARMNEALAALKGSSGKRNFLYDVPWYVVIGPPGAGKTTALVNSGLNFPLA
GSGDAQPVAGIGGTRACDWWFTDQAVLIDTAGRYTTQDSNAESDKKSWLSFLSLLKKHRARQPINGVILA
ISLADLMSFDDRQLDTHVAEIRNRLREIHETLKVQFPVYLIFTKADLVSGFMDYFGGFDESRRRKVWGAT
FQTAERDRNMAAGAPAEFDALAKRLADEMADRLQEEADPVTRISIFGFPAQFGALKGRVTSFVAALFDPG
RSQVNVSLRGLYFSSGTQEGTPIDQVLGAIGRNFGGNSRPHLSGTGKSFFLHDLLTDVIFAESGWVSYDK
SAARRAAIVRFGGLGAITLIAAAALGTLALSFASNRSLIASTTLAMGQYRETAAPLLKASTVTDVDLENV
IGPLDQLRDLPAGYETGDLPTPLEETFGLSQRERLLSASKTAYRQALERLLRSRLLIQAERTIQAKMADP
VALYEPLKIYLMLGGKAPKVDDALIVSWMKRDWEQNRYPGENNREGREQLQKHLRAMLALDDAYDPVFEL
NQPLVEAAQRSLGRMSLADRASALIKSAIYAAVLDDFSLSQKGGPEAQLLFERIDGGDLSGLRIPGIYTH
SGFNTFYLRQLSRIAQMLVDEQWVLGGGGEQGDINQQLLKLGPELLDRYGKEFAAAWNGVLGQLKFKAML
TDKPHYIALSAAASPSSPMNQLFAAIADETALTRDSGDGPDPGTEIEGTAQNPPRNPADLAKGLARIGIT
IASGKSQSRAGTGAADARNFSPGANIEAQFRPFQALVNGPAGHRPIDALTQNFSDIYQSLQLAAEVPSQT
ERVNSNLQLQIATLRANVSRLPKQLGRMVNATADEFEGNVAETSVTNLNQILDQTVTAPCEAAISGRYPF
ARDATEDVAMADFAKLFAPGGLLDRFFAQNLASLIDMTSQDWTWKQDARFGRDLSKSTLKDFQLAAEIRS
AFFPSGGSLPSVSITFTPFSLNGDVDTAILDAEGQIVWSNQTGNAPSAVTWPGEAASASASLSLTPEMPG
RESAIKFEGPWALKRLLDKAAVTGDDSNMQARFVIGGRDVTYALQTGSGSNPFFLPALSGFSCPKAF
 
Nucleotide Sequence: 3564 bp     [Download]
>gi|319777789|ref|NC_014918.1|:c310256-306693 Mesorhizobium ciceri biovar biserrulae WSM1271 plasmid pMESCI01, complete sequence
ATGACGCGTTGGCTGCTGCGGATATTCAGCATGACCGCGCTGATCGGCTTCGCGACGGCCATATGGTTTG
CCGGCCCCTTGATCCGCTTTGCCGATAGCCGGCCGCTCGGGCCTGCCTGGCTGCGTGCAACGATCATCGG
TGTAATCGTGGCGACGCTGGCGCTTTTTCACGGGCTGCGTTTCTGGCAGGGGAGGAAGGCGCAAAAAGCG
CTCGAAACCGTCGTTGCGCACAATGATGACCGCGATGATGACGATGGGCGGCTGCTCGAAGCCCGCATGA
ATGAGGCCTTGGCGGCGCTCAAAGGGTCGAGCGGCAAGCGCAACTTCCTCTACGACGTCCCCTGGTACGT
CGTCATAGGCCCGCCGGGTGCCGGCAAGACAACGGCACTGGTCAATTCGGGGCTGAATTTTCCGCTTGCC
GGTTCAGGAGACGCCCAACCGGTGGCCGGCATTGGCGGAACACGTGCCTGCGACTGGTGGTTTACCGACC
AGGCCGTGTTGATCGACACCGCAGGTCGCTACACGACGCAGGATTCCAATGCTGAGAGCGACAAGAAGAG
CTGGCTCTCCTTCCTGTCACTGCTCAAGAAGCACCGCGCCCGGCAACCGATAAACGGCGTCATCCTGGCC
ATCAGCCTTGCCGATCTGATGAGCTTCGACGACCGGCAGCTAGATACCCACGTCGCCGAGATACGCAACC
GGCTGAGGGAAATCCACGAGACGCTGAAAGTTCAGTTTCCAGTCTATCTGATTTTCACCAAGGCCGATCT
TGTCTCCGGTTTCATGGACTACTTCGGCGGTTTCGACGAGTCACGAAGGCGCAAGGTGTGGGGCGCGACA
TTCCAGACCGCGGAGCGCGACAGGAACATGGCCGCTGGAGCCCCTGCCGAATTCGATGCGCTGGCAAAAC
GACTGGCCGACGAGATGGCCGACCGCCTCCAGGAAGAGGCTGATCCCGTCACGCGCATCTCCATCTTCGG
TTTTCCGGCACAGTTCGGCGCACTAAAGGGCCGAGTTACCAGCTTTGTCGCCGCTCTGTTCGATCCCGGA
CGCAGCCAGGTGAATGTCAGCCTGCGTGGATTGTATTTTTCGTCCGGCACGCAAGAGGGCACGCCTATCG
ATCAGGTGCTGGGCGCGATCGGCCGCAATTTCGGCGGCAATTCCCGCCCTCACCTTTCTGGAACCGGCAA
AAGCTTCTTTTTGCATGATCTGCTGACGGACGTCATTTTTGCCGAATCGGGCTGGGTTTCGTATGACAAA
TCGGCTGCAAGGCGTGCGGCGATCGTCAGATTTGGTGGCCTGGGTGCCATAACGCTGATCGCCGCCGCCG
CACTGGGTACGCTCGCCCTGAGCTTTGCTTCCAACCGGTCGCTGATCGCCTCCACAACGCTGGCCATGGG
CCAGTATCGCGAGACGGCGGCCCCGTTGCTCAAGGCCAGCACGGTCACCGATGTCGACCTTGAAAACGTC
ATCGGCCCGCTTGACCAGTTGCGCGATCTGCCGGCGGGGTATGAAACCGGTGACTTGCCGACACCGTTAG
AGGAGACGTTCGGCCTCAGCCAGAGGGAGAGACTTCTTTCGGCATCCAAAACAGCCTATCGGCAGGCGCT
GGAGCGACTGCTCCGATCGCGCCTGTTGATCCAGGCCGAGCGGACGATCCAGGCCAAGATGGCCGATCCC
GTCGCCCTCTACGAACCGTTGAAAATCTATCTGATGCTTGGCGGCAAGGCACCGAAGGTCGATGACGCTT
TGATCGTTTCGTGGATGAAGCGGGACTGGGAGCAGAACCGATATCCGGGCGAAAACAATCGCGAAGGACG
CGAGCAGCTCCAAAAGCACCTGCGCGCCATGCTTGCATTGGACGACGCCTATGATCCGGTCTTCGAACTC
AACCAGCCGCTTGTCGAAGCCGCTCAACGTTCACTCGGGCGTATGAGCCTTGCCGATCGCGCTTCGGCCT
TGATCAAGTCGGCTATATACGCAGCGGTGCTGGACGATTTTTCACTGTCTCAGAAAGGCGGGCCGGAAGC
GCAGCTGCTGTTCGAGCGCATCGATGGCGGCGATCTGTCAGGGCTTCGTATTCCCGGCATCTATACTCAT
TCCGGCTTCAACACCTTCTATCTCCGGCAACTGTCGCGCATTGCGCAGATGCTTGTCGACGAGCAGTGGG
TTCTCGGGGGCGGCGGCGAACAAGGCGATATCAACCAGCAATTGCTCAAGCTCGGCCCCGAACTTCTTGA
TCGCTACGGCAAGGAGTTCGCGGCCGCGTGGAACGGCGTTCTCGGCCAGTTGAAATTCAAGGCGATGCTG
ACGGACAAGCCGCACTACATCGCGCTTTCGGCCGCTGCCTCCCCAAGCTCACCGATGAATCAGCTCTTTG
CGGCAATCGCCGATGAAACAGCTCTGACGCGGGACTCAGGTGACGGCCCCGATCCCGGCACCGAGATCGA
AGGCACGGCCCAGAACCCGCCGCGCAACCCCGCGGATCTGGCCAAGGGCCTGGCCCGCATCGGCATAACA
ATCGCCAGCGGCAAATCGCAAAGCCGCGCCGGCACCGGGGCCGCCGACGCACGGAACTTCAGTCCAGGAG
CAAACATCGAAGCGCAATTCAGACCATTCCAGGCCCTGGTGAACGGCCCTGCCGGACATCGCCCGATCGA
TGCTCTGACCCAAAACTTCAGCGATATCTATCAGAGCCTGCAACTGGCGGCCGAAGTTCCTTCGCAGACG
GAACGCGTCAATTCGAACCTGCAGCTGCAGATAGCCACGCTTCGCGCCAATGTCTCGCGCCTGCCCAAGC
AACTCGGCCGGATGGTCAACGCGACGGCGGATGAGTTCGAAGGCAACGTTGCCGAAACCTCGGTGACCAA
CTTGAATCAGATACTTGACCAGACGGTCACAGCCCCTTGTGAAGCCGCAATCAGCGGCCGTTATCCCTTC
GCCCGCGACGCCACCGAGGATGTTGCGATGGCAGATTTCGCCAAATTGTTCGCCCCTGGCGGCTTGCTGG
ACCGGTTCTTCGCACAAAATCTAGCATCGCTGATCGACATGACCAGCCAGGACTGGACTTGGAAACAGGA
TGCGCGATTTGGACGCGACCTGTCGAAATCGACCCTGAAAGACTTCCAGCTTGCGGCGGAAATCCGCAGC
GCCTTCTTCCCATCGGGCGGTTCGTTGCCTTCGGTCAGCATCACTTTCACACCGTTCTCACTGAATGGCG
ATGTCGATACGGCGATACTCGATGCCGAAGGCCAGATCGTCTGGAGCAATCAGACGGGCAACGCGCCGAG
CGCGGTCACCTGGCCGGGCGAGGCAGCTTCCGCGTCCGCCAGCCTAAGCTTGACGCCGGAGATGCCAGGC
CGCGAATCCGCCATCAAGTTCGAAGGGCCCTGGGCGCTGAAACGACTTCTGGACAAGGCTGCCGTCACCG
GCGACGACAGCAACATGCAAGCGCGCTTCGTGATCGGCGGACGCGACGTTACTTATGCTCTCCAGACAGG
CTCAGGCTCCAACCCCTTCTTCCTCCCGGCCCTGTCCGGATTCAGCTGTCCCAAGGCGTTTTGA
 Primer design