SecReT6
Protein ID: 319778882
SecReT6 ID415
T6SS typei3
Gene symbol-
Locus tagTEQUI_0714
StrainTaylorella equigenitalis MCE9
Repliconchromosome [GenBank: NC_014914] [Browse all T6SS(s) in this replicon]
Location [Strand]740468..744094 [+]
ProductIcmF-related protein
NoteTssM
UniProt IDE8UFN8
KEGG IDteq:TEQUI_0714
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.60E-90, Aligned region: 213..478
ImcF-related_N [PF14331], Evalue: 4.60E-90, Aligned region: 1062..1078
IcmF-related [PF06761], Evalue: 1.70E-79, Aligned region: 232..268
IcmF-related [PF06761], Evalue: 1.70E-79, Aligned region: 529..837
DUF1215 [PF06744], Evalue: 7.00E-33, Aligned region: 720..745
DUF1215 [PF06744], Evalue: 7.00E-33, Aligned region: 948..1070
Protein Sequence: 1208 a.a.     [Download]
>gi|319778882|ref|YP_004129795.1| IcmF-related protein [Taylorella equigenitalis MCE9]
MFSLINLFITRIFSFLFSRALWSFLGLVILSCLIWFLGPALRVGEFAPLESRDVRMYLIIAIFALYFLRL
FWRKYREGRLNAKLLGQLKSKKPKDNEKLTEKEREEVRVLSERFDEAIALLKQSRFENGKDKSLSARFSK
QYLYQLPWYVFIGAPGSGKTTALVNSGLNFPLAEKFGRMALKGVGGTRNCDWWFTDEAVLLDTAGRYTTQ
DSNTATDEDEWKGFLKLLTKYRARQPINGVMLTVSVYDLLASTQEERAKHAVALKKRLQELRDELGTEFP
VYILVTKMDQLHGFEDYFDNLSVEEHQQVWGFTFPYEESQEEGFSFYDSYEKEFQILQERLFDGLPDLLM
KNRNLESSSLAYLLPQQFANLRIVLGTFLTEVFSFSRLESKIVPRGVYFTSGTQGGVSFDKVSEDLKDYL
QIDGISQHNKAPVLEGGKSYFLTDLLQNLIFKESGLAGVNLKWEKRYRQMQWIGYGLVGLLLLGALTLWF
NSYRNNTRYLDFVEEKLPVLQNHSNNIKISESGDVFSILPYLSLVKKLPNGETFNVEDAPFSYGFGLYQG
GKIKSASRSIYDEAIHQVFAPQIAKRIEKRLATMSDANIVVYYEALRAYLMMYEPEHYDKDYFMQWVLHD
VVADKSAQFNNEQFQLLREHMDYLFGQGAFVSPFPLNEELVQLARDRIDAHDLAERAYNRAREILKQDSK
YDVSLMNLAGVQASTVFRRKSGDALNKGVNRIFSYEGYWNNFNKNIEKIAIQLREDDEWVLGINNTKFAD
GSANKLVNDVKKLYFVDYIREWDAFLADVEVIPPKNLSHAIELSRSMSSSNSPLTKFVKGVAADTTLLRE
DVDFQRTLVDRATESASSMASSLTSLMGPLDTGDLIKGKEEPEKLESMVDNHFIDYHELAVSAGNNQDAP
IEGTIDLIEELYNFLTASETALRTKVTLPSQDVISKLQAESGRLPPVVGNMLTSITAEASKAINSGAQAN
IGADINAQIGMSCRNSITNRYPFRSTTRDVAPNDFARFFAPNGLMDQFFNKHLINMVDMSKHPWRFKPGV
DGSKGNIAKYLSSFEKASVIRDVYFAGGKPEPSFKVSIRPVEMDASITQMVLNIDGQTLTYEHGPQIGKS
FDWPGQGSNQVSITLSPIDGTSSLTTNGPWALNRLIDNAKIKNGRSPEVIFATFNIGGRSVKLEITANSA
KSPFRLGEMRSFTCPGVN
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|319778189|ref|NC_014914.1|:740468-744094 Taylorella equigenitalis MCE9 chromosome, complete genome
ATGTTCAGCCTTATAAATTTGTTTATCACAAGAATTTTTAGTTTTTTGTTTAGTAGAGCTTTGTGGTCAT
TTCTTGGCCTTGTAATTCTTTCTTGTTTGATTTGGTTTTTAGGTCCTGCACTAAGGGTTGGAGAGTTTGC
TCCACTTGAATCTCGTGATGTGAGGATGTACTTAATCATTGCCATCTTTGCACTTTATTTCTTAAGGTTG
TTTTGGAGGAAATATCGAGAAGGACGGCTTAATGCAAAGCTCTTAGGACAACTTAAAAGCAAAAAACCTA
AGGACAATGAAAAACTTACCGAGAAAGAGCGTGAAGAAGTCAGAGTATTATCAGAACGCTTCGATGAGGC
GATTGCACTTTTAAAACAATCCCGATTTGAAAATGGTAAAGACAAATCGTTATCTGCTAGATTTTCTAAA
CAATATCTTTATCAATTGCCTTGGTATGTGTTTATTGGGGCTCCAGGTTCAGGTAAAACTACGGCTTTAG
TAAATTCTGGGCTTAATTTTCCATTGGCAGAGAAATTTGGTCGTATGGCTCTTAAAGGCGTGGGAGGTAC
TCGTAATTGTGATTGGTGGTTTACTGATGAGGCTGTACTTCTGGATACCGCAGGTCGATACACTACACAA
GATAGTAATACTGCGACTGACGAAGATGAGTGGAAGGGTTTCTTAAAACTTCTTACAAAATATCGAGCAA
GGCAGCCGATTAATGGTGTTATGTTGACTGTCAGTGTGTACGACTTGCTTGCTTCAACTCAAGAGGAGCG
TGCGAAACACGCAGTTGCACTTAAAAAACGTCTCCAAGAATTACGCGATGAATTGGGTACGGAGTTTCCT
GTTTATATTCTCGTTACTAAGATGGACCAATTGCATGGTTTTGAGGATTACTTCGATAACCTTAGTGTTG
AGGAGCATCAGCAGGTTTGGGGTTTCACGTTCCCGTATGAAGAGTCTCAAGAGGAGGGATTTAGTTTCTA
CGATTCGTACGAAAAAGAATTCCAAATTCTGCAAGAGCGTTTATTCGACGGGCTTCCAGATTTGTTAATG
AAAAACAGGAATTTAGAAAGCAGTTCATTGGCGTATTTATTGCCACAGCAATTTGCAAATTTAAGAATTG
TACTTGGCACTTTCCTAACTGAAGTTTTCTCATTTAGTCGCTTGGAATCTAAAATTGTTCCACGTGGCGT
TTACTTCACTAGCGGAACTCAGGGTGGTGTTAGTTTCGATAAAGTTAGTGAGGACTTAAAAGATTATCTG
CAAATCGACGGCATTTCTCAGCACAACAAAGCACCTGTGCTTGAGGGCGGAAAAAGCTATTTCCTAACCG
ACCTACTTCAAAATTTAATTTTCAAGGAATCAGGTTTAGCTGGTGTGAATCTGAAGTGGGAGAAGCGTTA
TCGTCAAATGCAGTGGATTGGGTATGGTTTAGTTGGGTTGCTTTTGCTAGGAGCCTTAACTCTTTGGTTT
AATAGCTACCGCAATAACACTAGATATCTTGATTTTGTGGAAGAGAAATTACCAGTACTTCAAAATCATA
GTAACAACATTAAAATTTCTGAAAGTGGTGATGTTTTCAGTATATTGCCTTACCTCAGTTTAGTTAAAAA
GCTTCCAAACGGTGAGACTTTCAATGTTGAGGATGCTCCGTTTTCTTATGGCTTTGGTTTGTACCAGGGT
GGCAAAATTAAATCAGCTTCGCGCTCTATATACGATGAGGCTATTCATCAGGTTTTTGCACCTCAGATAG
CTAAAAGAATTGAAAAACGTTTAGCCACAATGAGCGATGCAAATATCGTTGTTTATTACGAGGCTTTACG
TGCTTATTTAATGATGTATGAACCCGAACACTACGATAAAGACTACTTTATGCAGTGGGTGCTTCATGAT
GTAGTAGCCGATAAATCTGCTCAATTCAATAACGAACAGTTCCAGTTACTTCGTGAGCATATGGATTATT
TATTTGGACAGGGTGCTTTTGTATCTCCATTCCCATTAAATGAGGAATTAGTGCAGTTGGCACGTGACCG
TATAGATGCTCATGACTTAGCTGAACGTGCCTACAATCGAGCAAGAGAAATTCTAAAACAAGATTCAAAA
TACGATGTATCACTTATGAACCTTGCTGGGGTGCAGGCCTCCACAGTATTCCGTCGTAAAAGTGGTGATG
CTTTGAATAAAGGTGTAAATAGAATTTTCTCTTATGAGGGATATTGGAATAACTTCAATAAAAATATTGA
AAAGATTGCCATCCAACTTAGAGAAGATGATGAGTGGGTTCTCGGGATTAACAACACAAAATTTGCTGAT
GGCAGTGCAAACAAACTTGTTAATGATGTAAAAAAACTCTACTTTGTAGACTATATCAGGGAGTGGGATG
CCTTCTTAGCGGATGTGGAAGTAATTCCACCTAAAAATTTAAGTCATGCAATTGAGCTTTCTCGCAGTAT
GTCATCATCTAATTCACCTCTTACAAAATTTGTTAAGGGTGTAGCTGCAGACACAACATTGCTTCGTGAG
GATGTTGACTTCCAAAGAACATTGGTTGATAGGGCTACAGAAAGTGCCTCAAGTATGGCATCTTCGCTAA
CTTCCTTGATGGGACCTCTTGATACGGGTGACCTTATTAAGGGTAAAGAAGAGCCTGAAAAACTTGAGTC
CATGGTTGATAACCACTTTATCGATTACCATGAGTTAGCTGTCAGTGCTGGCAATAATCAAGATGCGCCT
ATTGAAGGCACTATTGACTTAATCGAGGAGTTATACAATTTCTTGACGGCTTCTGAGACCGCACTTAGGA
CCAAAGTAACATTGCCATCCCAAGATGTTATTTCTAAGCTTCAGGCTGAATCAGGTCGTTTACCACCTGT
TGTGGGTAACATGCTTACTTCGATTACTGCAGAAGCTTCAAAAGCGATTAACTCTGGAGCACAAGCCAAT
ATCGGTGCGGATATTAATGCACAGATAGGTATGTCTTGCAGGAACTCGATTACAAACAGATATCCATTTA
GATCTACTACTAGGGATGTGGCTCCTAATGATTTTGCTAGATTCTTTGCACCAAATGGTTTGATGGATCA
ATTCTTTAATAAGCACTTAATCAATATGGTGGATATGTCCAAACATCCATGGCGTTTTAAACCAGGTGTA
GACGGCTCAAAAGGGAATATTGCCAAATATCTTTCTTCTTTCGAAAAAGCATCTGTAATTCGTGATGTTT
ATTTTGCTGGTGGCAAACCTGAACCTTCTTTTAAAGTGTCTATTAGGCCAGTTGAGATGGATGCAAGTAT
AACTCAGATGGTTCTTAATATTGATGGTCAAACTCTGACTTATGAACACGGTCCACAAATTGGTAAGTCG
TTTGATTGGCCAGGTCAGGGAAGCAATCAAGTTTCAATTACTCTTAGCCCGATTGATGGAACATCATCCT
TGACGACAAATGGTCCATGGGCTTTAAACCGTCTTATCGATAATGCAAAAATTAAAAATGGTCGCTCGCC
TGAAGTAATTTTCGCAACGTTTAATATTGGGGGACGTTCTGTGAAACTTGAAATCACAGCCAATTCCGCT
AAGAGCCCGTTCAGACTTGGCGAGATGCGCAGTTTTACTTGCCCAGGAGTTAACTAA
 Primer design