SecReT6
Protein ID: 319791245
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0553
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]610673..614272 [+]
Producttype VI secretion protein icmf
NoteTssM
UniProt IDE6V5G8
KEGG IDvpe:Varpa_0553
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.90E-96, Aligned region: 206..472
ImcF-related_N [PF14331], Evalue: 1.90E-96, Aligned region: 524..585
IcmF-related [PF06761], Evalue: 5.10E-88, Aligned region: 521..832
DUF1215 [PF06744], Evalue: 1.90E-32, Aligned region: 937..1058
Protein Sequence: 1199 a.a.     [Download]
>gi|319791245|ref|YP_004152885.1| type VI secretion protein icmf [Variovorax paradoxus EPS]
MIKKIFGFLFSPLLLTLLALIVVGLLIWWIGPLVKIGSLAPLESELARWLLIGAIVLIVVLRMAWRRWRA
RRASQHLTDGLMKAPTVKTDAPANGEQKILDTRFSEAVATLKQMRLHAAGKKPGWRDWMSISGGSYLYDL
PWYVFIGAPGAGKTTALVNSGLSFPLAEKFGPGAIRGVGGTRNCDWWFTDEAVLIDTAGRYTTQDSHQTE
DKNAWEGFLGLLKKARPRRPLNGVFLTVSVADLLSQGPEQRTQLAASIRARLLELDSKLTTRLPVYVLVT
KSDLLYGFTDYFDDLGKEQRAQVFGFTLPADENVQTEEKGLSTAFHREFALLHNRVNDGLIPRMQRETDG
GRRAAIFGFPAQFGSIGSLLSDLLDQVFTGSRFAQPPWVRGVYFTSGTQEGSPIDRVMGSLSRSFGIERA
MLAPQKSSGRSYFLTSLLRDVVFPEQRLAGADVKLERRRHLLRMTGVAAMTLVTVGLIAGWGYSTWQNTN
YLKSVEARAVPAQKSLANLPVQLQNLVEVAPVMQGIRDIWKTPENRQGDEPLSMTLGLYQGNKLDAAARL
AHQRALNDVFLPQIAKRIEDQLRTAQKDNLEYTYEALKSYLMLYQPEHFDPEALKAWITLDWARSLDRGI
PEEQRMALEEQLDVLIAQGPPRSPLKMDENLVRSVRAVLASYPLEQRVFSRLKRQRATKDIPGFSVATAA
GPSAPLVFERISGKPLTEGVPGMFTYDGYHKRFQNEVTVLTGLLAAEDPWVLGQDKGAADRLRDVAALGA
LTDRVRRLYLAEYVKQWEALLGDVRLIRATGLDKNIEAARILSGVSSPLANFLRAVVKETTLIPADQPKD
VVSKATATVASTRKGLEDLFGGDPNKPVATGKRIESIVDDRFEPLRRLVTAAAPGQPAPIDDALKLFNEV
YVYLNAVDTAVKGRTSPPPGDVAGKLKADAGRLPEPVRSMVENLSQSGAAQAQVAERGNLSQDLRPVTEF
CARAIAGRYPFSPTSKRDVLPEDFGQMFGAGGLMDDFFQKRLAALVDTSTRPWRYKPVAERGAITTQALA
QFERAARIKDIFFRAGGRGPSMRLDFKPVEMDAGITQFILDVDGQLVKYAHGPVVPMAVQWPGPKGSNQV
RIQVSPPSTTGSSGSAVDGPWALFRALDDGQLEAGDAPEKFFITFQIGARKTRFEVTTNSVQHPIRLREL
REFSCPEGL
 
Nucleotide Sequence: 3600 bp     [Download]
>gi|319790694|ref|NC_014931.1|:610673-614272 Variovorax paradoxus EPS chromosome, complete genome
ATGATCAAGAAAATCTTCGGCTTCCTGTTCAGTCCGCTGCTGCTGACGCTGCTCGCGCTCATCGTCGTCG
GGCTCCTGATCTGGTGGATCGGACCGCTGGTGAAGATCGGTTCGCTCGCCCCGCTCGAAAGCGAGTTGGC
GCGCTGGCTGCTGATCGGCGCCATCGTGCTCATCGTCGTGCTGCGCATGGCGTGGCGGCGCTGGCGCGCG
CGCCGTGCGAGCCAGCACCTGACCGATGGCCTCATGAAAGCGCCGACGGTGAAGACCGACGCACCGGCCA
ATGGCGAGCAGAAGATTCTCGATACGCGCTTCAGCGAAGCCGTCGCCACCTTGAAGCAGATGCGCCTGCA
CGCCGCCGGCAAGAAGCCGGGCTGGCGCGACTGGATGTCCATCTCGGGCGGCAGCTATCTGTATGACCTG
CCTTGGTACGTCTTCATCGGCGCGCCCGGTGCTGGCAAGACGACGGCACTCGTGAACTCGGGCCTGTCGT
TCCCGCTCGCCGAGAAGTTCGGCCCCGGCGCGATCCGCGGTGTGGGCGGCACGCGCAACTGCGACTGGTG
GTTCACCGACGAGGCGGTGCTCATCGACACCGCCGGCCGCTACACCACGCAGGACAGCCACCAGACCGAG
GACAAGAACGCATGGGAAGGCTTCCTCGGCCTGCTCAAGAAAGCGCGCCCGCGCCGTCCGCTGAACGGCG
TGTTCCTCACGGTGAGCGTCGCCGACTTGTTGAGCCAAGGGCCCGAGCAGCGCACGCAACTCGCCGCATC
GATCCGCGCGCGTTTGCTCGAACTCGACAGCAAGCTCACGACCCGCCTGCCGGTGTATGTGCTCGTCACC
AAGAGCGACCTGCTCTACGGCTTCACCGATTACTTCGACGACCTCGGCAAGGAGCAGCGCGCGCAGGTCT
TCGGCTTCACGCTGCCGGCCGACGAGAACGTGCAGACCGAAGAGAAGGGCCTCTCCACCGCCTTCCATCG
CGAGTTCGCGCTGCTGCACAACCGCGTGAACGACGGCCTCATTCCGCGCATGCAGCGCGAGACCGACGGT
GGGCGCCGCGCGGCGATCTTCGGTTTCCCGGCGCAGTTCGGCTCCATCGGCTCGCTGCTGTCGGACCTGC
TCGACCAGGTGTTCACCGGCTCGCGCTTCGCGCAGCCGCCGTGGGTGCGAGGCGTGTACTTCACCAGCGG
CACGCAGGAGGGCAGCCCGATCGACCGCGTGATGGGCAGCCTGTCGCGCAGCTTCGGCATCGAGCGCGCG
ATGCTCGCGCCGCAGAAGTCGAGCGGCCGCAGCTACTTCCTCACATCGCTGCTGCGCGACGTGGTGTTTC
CCGAGCAGCGCCTCGCAGGCGCCGACGTGAAGCTGGAGCGCCGCCGCCATCTGCTGCGCATGACGGGCGT
GGCCGCGATGACGCTGGTCACGGTCGGCCTCATCGCGGGCTGGGGCTACAGCACCTGGCAGAACACGAAC
TACCTGAAGTCGGTGGAAGCGCGCGCCGTGCCCGCGCAGAAGAGCCTGGCCAATCTTCCGGTGCAACTGC
AGAACCTGGTCGAGGTCGCGCCCGTGATGCAGGGCATACGCGACATCTGGAAGACACCCGAGAACCGCCA
GGGCGATGAGCCGCTCAGCATGACGCTGGGCCTCTACCAGGGCAACAAGCTCGACGCCGCCGCGCGCCTT
GCGCACCAGCGCGCGCTCAACGACGTGTTCCTGCCGCAGATCGCCAAGCGCATCGAGGACCAGCTGCGCA
CCGCGCAGAAGGACAACCTGGAGTACACGTACGAAGCGCTCAAGAGCTATTTGATGCTCTACCAGCCCGA
GCACTTCGACCCCGAGGCGCTGAAGGCCTGGATCACGCTCGACTGGGCGCGCAGCCTGGACCGCGGCATT
CCCGAAGAGCAGCGCATGGCGCTCGAAGAGCAGCTCGACGTGCTCATCGCCCAAGGCCCGCCGCGCTCGC
CGCTCAAGATGGACGAGAACCTCGTGCGCAGCGTGCGCGCCGTGCTCGCGAGCTATCCGCTGGAACAGCG
CGTGTTCAGCCGCCTGAAGCGCCAGCGCGCGACCAAGGACATTCCGGGCTTCAGCGTGGCGACGGCCGCC
GGCCCCTCGGCGCCGCTCGTGTTCGAGCGCATCAGCGGCAAGCCGCTGACCGAAGGCGTGCCGGGCATGT
TCACCTACGACGGCTATCACAAGCGCTTCCAGAACGAAGTGACGGTGCTCACCGGCCTGCTCGCCGCCGA
AGACCCGTGGGTGCTCGGACAGGACAAGGGCGCCGCCGACCGCCTGCGCGACGTGGCCGCGCTCGGCGCG
CTGACCGACCGCGTGCGCCGCCTGTACCTCGCCGAGTACGTGAAGCAATGGGAAGCGCTGCTCGGCGATG
TGCGGCTGATTCGCGCCACGGGTCTCGACAAGAACATCGAGGCCGCGCGCATTCTCTCGGGCGTGAGCTC
GCCGCTCGCGAACTTCCTGCGCGCCGTGGTGAAGGAGACCACGCTGATCCCCGCCGATCAACCGAAGGAC
GTGGTGAGCAAGGCCACCGCCACCGTCGCCAGCACCCGCAAGGGCCTGGAAGACCTGTTCGGCGGCGACC
CCAACAAGCCGGTCGCGACCGGCAAGCGCATCGAGAGCATCGTGGACGACCGCTTCGAGCCGCTGCGCCG
CCTGGTCACCGCCGCGGCGCCCGGCCAGCCCGCGCCGATCGACGATGCATTGAAGCTCTTCAACGAGGTG
TACGTGTACCTCAACGCGGTCGACACGGCAGTGAAGGGCCGCACCTCGCCGCCGCCCGGCGATGTGGCCG
GCAAGCTCAAGGCCGATGCCGGCCGGCTGCCCGAGCCGGTGCGCTCGATGGTCGAGAACCTGAGCCAGTC
GGGCGCCGCGCAGGCGCAGGTGGCCGAGCGCGGCAACCTGAGCCAGGACCTGCGCCCCGTGACCGAGTTC
TGCGCGCGTGCCATCGCGGGCCGCTATCCGTTCTCGCCCACCAGCAAGCGCGATGTGCTGCCCGAGGACT
TCGGCCAGATGTTCGGCGCCGGTGGCCTGATGGACGACTTCTTCCAGAAGCGGCTGGCTGCATTGGTCGA
TACGAGCACGCGGCCGTGGCGCTACAAGCCCGTGGCCGAGCGCGGCGCGATCACCACGCAGGCGCTCGCG
CAGTTCGAGCGTGCCGCGCGCATCAAGGACATCTTCTTCCGCGCGGGTGGCCGCGGGCCTTCGATGCGGC
TGGATTTCAAGCCGGTGGAGATGGATGCGGGCATCACGCAGTTCATCCTCGATGTCGATGGGCAGCTCGT
GAAGTACGCGCATGGCCCCGTGGTGCCGATGGCGGTGCAGTGGCCGGGGCCGAAGGGCAGCAACCAGGTG
CGCATCCAGGTGAGTCCGCCTTCGACGACCGGCAGTTCGGGCTCGGCGGTCGATGGGCCGTGGGCGCTGT
TCCGTGCGCTGGACGATGGACAGCTCGAAGCCGGTGATGCGCCGGAGAAGTTCTTCATCACCTTCCAGAT
CGGCGCGCGCAAGACGCGTTTCGAGGTGACGACGAACAGCGTGCAGCATCCGATTCGCTTGCGTGAGCTG
CGGGAGTTTTCTTGTCCGGAGGGGTTGTGA
 Primer design