SecReT6
Protein ID: 319791281
SecReT6 ID417
T6SS typei3
Gene symbol-
Locus tagVarpa_0589
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]656848..657987 [-]
Producthypothetical protein
NoteTssM
UniProt IDE6V6E7
KEGG IDvpe:Varpa_0589
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.00E-33, Aligned region: 56..77
ImcF-related_N [PF14331], Evalue: 7.00E-33, Aligned region: 154..357
Protein Sequence: 379 a.a.     [Download]
>gi|319791281|ref|YP_004152921.1| hypothetical protein Varpa_0589 [Variovorax paradoxus EPS]
MTALLSSPTHFFWMLLALCLLGFGLLCAMVHDAGRGARRRALLRRIETLDAPTDEAAVGALRESMAEARQ
ALRQQAPRPARSSHDPAAPVPWFLFIGDAAADLPGLLATAQGKRLARPDSAPDDGACWRWWLTGALTAIE
VQPAAVGEAAGAPRTRALWLQALLALAERRDRLPLNGVVACFSASELLQADADSLRPLAAKMRRLIDEAG
DTLRLQLPMYLVITGLEHLTGYAALRGALPPEVLAQALGHRLPDPFAAPSATAGDRLDTLFDPIAAQLQS
LRMALMREQHGAAARLSIHGFVEAVQGLQPALREVAEVLFESHGKGSRAPRWRGLYFTAAASDATGGAFV
TDLFERFLPADQPLVRPGRPSSNTAAGAP
 
Nucleotide Sequence: 1140 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c657987-656848 Variovorax paradoxus EPS chromosome, complete genome
ATGACCGCGCTGCTCTCCTCGCCCACGCACTTCTTCTGGATGCTGCTCGCGCTGTGCCTGCTGGGCTTCG
GGCTGCTGTGCGCGATGGTGCACGACGCGGGCCGCGGTGCGCGGCGGCGTGCCTTGCTGCGCCGCATCGA
GACGCTCGATGCGCCCACGGACGAGGCGGCCGTCGGGGCGCTGCGGGAATCGATGGCAGAGGCGCGTCAG
GCGCTGCGGCAGCAGGCGCCGCGGCCCGCACGGTCGTCGCACGACCCGGCTGCGCCGGTGCCGTGGTTCC
TGTTCATCGGCGATGCGGCGGCCGACCTGCCGGGGCTGCTGGCCACCGCGCAGGGCAAGCGCCTCGCGCG
GCCCGACAGCGCCCCCGACGATGGGGCCTGCTGGCGCTGGTGGCTGACCGGTGCGCTGACCGCCATCGAG
GTGCAGCCCGCGGCGGTCGGCGAAGCCGCCGGCGCACCGCGCACGCGCGCCCTGTGGCTGCAGGCGCTGC
TGGCGCTGGCCGAGCGGCGCGACCGCCTGCCGCTCAACGGCGTGGTCGCGTGCTTCTCCGCGAGCGAGCT
GCTGCAGGCCGACGCCGACAGCCTGCGCCCCCTTGCCGCGAAGATGCGCCGGCTGATCGACGAGGCGGGC
GACACCCTGCGCCTGCAGTTGCCCATGTACCTCGTCATCACCGGCCTGGAGCATCTGACGGGCTACGCCG
CCCTGCGCGGCGCGCTGCCGCCCGAGGTGCTGGCGCAGGCGCTGGGCCATCGCCTGCCGGACCCGTTTGC
CGCGCCCAGCGCAACCGCCGGCGATCGGCTCGATACGCTGTTCGACCCCATCGCCGCGCAACTGCAGAGC
CTTCGCATGGCGTTGATGCGCGAGCAGCACGGGGCCGCGGCGCGGCTCTCGATCCATGGGTTCGTGGAAG
CGGTGCAGGGATTGCAGCCCGCATTGCGCGAGGTGGCGGAGGTCTTGTTCGAGAGCCACGGCAAGGGCTC
GCGCGCGCCGCGCTGGCGCGGCCTCTACTTCACTGCCGCCGCATCGGATGCAACTGGCGGGGCCTTCGTG
ACCGATCTGTTCGAGCGCTTCCTGCCGGCCGATCAGCCCCTGGTGCGACCAGGGCGTCCGTCGTCCAACA
CAGCGGCAGGTGCGCCATGA
 Primer design