SecReT6
Protein ID: 319793583
SecReT6 ID418
T6SS typei3
Gene symbol-
Locus tagVarpa_2921
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3148599..3152234 [+]
Producttype VI secretion protein icmf
NoteTssM
UniProt IDE6V5X1
KEGG IDvpe:Varpa_2921
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.90E-99, Aligned region: 207..471
ImcF-related_N [PF14331], Evalue: 9.90E-99, Aligned region: 836..866
ImcF-related_N [PF14331], Evalue: 9.90E-99, Aligned region: 1061..1075
IcmF-related [PF06761], Evalue: 7.00E-89, Aligned region: 526..836
DUF1215 [PF06744], Evalue: 5.80E-35, Aligned region: 309..354
DUF1215 [PF06744], Evalue: 5.80E-35, Aligned region: 945..1068
Protein Sequence: 1211 a.a.     [Download]
>gi|319793583|ref|YP_004155223.1| type VI secretion protein icmf [Variovorax paradoxus EPS]
MLRSIFRFLIGRDLWIFLGLLAVAFLIWVIGPVIAVGRYRPLEGEFVRIAVIALMFAIWIVRLAYRKWRE
RRLNAQLLNQLRVPSKKEKEARPEDAPEIKELQSGFTDATAILKNMRFGQGAGGKPASRFSVFDRQYLYQ
LPWYIFIGAPGSGKTTALVNSDLDFPLADQLGKAAVRGIGGTRNCDWWFTNEAVLIDTAGRYTTHESNRE
TDEGEWKGFLDLLKKFRPRQPINGAILTISIADLPLADDAQRARHAMALRKRLLELRNDLGIDFPVYVLV
TKTDLLAGFNEYFGSLGRAERAQVWGFTFPIEANPADAAKADLRERFHQEYKLLHQRLDERLPELMAAEP
DQMRRAQAYLLPQQFASFEDILGTFLADVFNPSKFEAASMLRGVYFTSGTQEGTAFDRVMGAIKRYLQVN
APPAPPPGPGKSYFLKELLQQVIFRDAGVAGTNLRWYRRRRAIDIAGYSLIGVLLVVLLGACVNSWRNNK
DYVAEVDNNAKAFNKAAARGELPTVVDASGDLASSLLILDRLRDLPKSGRFDIGDPPVSYRFGLYQGEKL
QAATDGVYQRALESVLLPQAAQRIEQSLRDAAKIDAEYSYEALKAYLMLYDAERYDADFLQAWLLTDVDR
KIGASLTREQRTNLESHLKALFAGRVVTSPFAKDDKLITQTRERLAGVPLAQRSYARLRRILLQTSPPNA
FTIAEMAGAESALVIRRASGKPLTDGIPTLFTYRGYWDIFDKRMAETTLALEQEDRWVLQIRAPGMTDIT
SRELLLREVRRLYLTDYIRVWDEYLADVRLAESKSLLQSIQMTRVLSTGESPMSRLIRGAARETDLLRNH
DEAARSLLDQAQNRVASTRERIEQLIGQPDGSQRRNAAPDRPESLVDNHFEPLRRMVTAPKAGGQTPLDA
TAALINELYTFLTATDTALRSGNIPPSSDAVTKVQAEAGRLPVPFQGMLNDLSATASSKAAAVTRQNIGQ
NAAATIGQFCNQAIAGRYPFSRGSPRDVAAGDFAQLFAPGGMMDDFFQKNLASQVDTSVNPWTFKRGVDG
SAAGRSAYLDSFQKAQAIRDVFFTGMAGSRTPSFTIDLRPEDMDAAITQFTLDIDGQTVRYAHGPQAPST
VKWPGPRNSNQVRLQVTTANGTPAGGIVTEGPWALHRLFDKASISAGRSPESFNATFDLQGKKVVLAVTA
NSVYNPLRLNQMSGFSCPGKS
 
Nucleotide Sequence: 3636 bp     [Download]
>gi|319790694|ref|NC_014931.1|:3148599-3152234 Variovorax paradoxus EPS chromosome, complete genome
ATGCTGCGTTCCATCTTCCGTTTTCTCATCGGCCGCGACCTGTGGATTTTTCTCGGCCTGCTGGCCGTGG
CGTTCCTGATCTGGGTCATCGGCCCGGTCATCGCCGTGGGCCGCTACCGGCCGCTGGAAGGCGAGTTCGT
CCGCATCGCCGTCATCGCGCTGATGTTCGCGATCTGGATCGTGCGGCTGGCCTATCGCAAGTGGCGCGAG
CGCAGGCTCAATGCGCAACTGCTCAACCAGCTGCGCGTGCCTTCGAAGAAGGAAAAAGAGGCCAGGCCCG
AAGATGCGCCCGAGATCAAGGAGCTGCAGAGCGGCTTCACCGACGCCACCGCGATCCTGAAGAACATGCG
CTTCGGGCAGGGCGCCGGCGGCAAGCCCGCGAGCCGCTTCTCGGTGTTCGACCGGCAGTACCTGTACCAG
CTGCCCTGGTACATCTTCATCGGCGCGCCGGGCTCGGGCAAGACCACGGCGCTGGTCAACTCCGACCTGG
ACTTTCCGTTGGCCGACCAGCTCGGCAAGGCCGCGGTGCGCGGCATCGGCGGCACGCGCAACTGCGACTG
GTGGTTCACCAACGAGGCGGTGCTGATCGACACCGCGGGCCGCTACACCACGCACGAAAGCAACCGCGAA
ACCGACGAGGGCGAGTGGAAGGGCTTTCTCGACCTGCTCAAGAAATTCCGCCCGCGCCAGCCGATCAACG
GCGCGATCCTCACCATCAGCATCGCCGACCTGCCGCTGGCCGACGACGCGCAGCGGGCGCGCCACGCAAT
GGCGCTGCGCAAGCGCCTGCTGGAACTGCGCAACGACCTGGGCATCGACTTTCCGGTCTATGTGCTGGTC
ACCAAGACCGACCTCCTGGCCGGCTTCAACGAGTACTTCGGCTCGCTGGGCCGCGCCGAGCGCGCGCAGG
TGTGGGGCTTTACCTTTCCCATCGAAGCCAACCCCGCGGATGCCGCGAAGGCCGATCTTCGCGAGCGCTT
TCACCAGGAATACAAGCTGCTGCACCAGCGCCTGGACGAGCGCCTGCCCGAGCTGATGGCCGCCGAGCCC
GACCAGATGCGACGCGCGCAGGCCTACCTGCTGCCGCAGCAGTTCGCGAGCTTCGAGGACATCCTGGGCA
CCTTCCTGGCCGACGTGTTCAACCCGTCGAAGTTCGAGGCCGCGTCGATGCTGCGCGGCGTGTACTTCAC
CAGCGGCACGCAGGAGGGCACGGCCTTCGACCGCGTGATGGGCGCGATCAAGCGCTACCTGCAGGTCAAT
GCGCCGCCCGCGCCGCCGCCGGGTCCGGGCAAGAGCTACTTCCTGAAAGAACTGCTGCAGCAAGTGATCT
TCCGCGACGCGGGCGTGGCCGGCACCAACCTGCGCTGGTACCGGCGCCGCCGCGCCATCGACATCGCGGG
CTACAGCCTCATCGGCGTGCTGCTCGTGGTGCTGCTGGGCGCCTGCGTGAACAGTTGGCGCAACAACAAG
GACTACGTGGCCGAGGTCGACAACAACGCCAAGGCCTTCAACAAGGCCGCGGCGCGCGGCGAGTTGCCGA
CGGTGGTCGATGCGAGCGGCGACCTCGCGAGTTCGCTCCTGATCCTGGACCGCCTGCGCGACCTGCCCAA
GTCGGGCCGCTTCGACATCGGAGATCCGCCGGTGTCCTACCGCTTCGGCCTTTACCAGGGCGAGAAGCTG
CAGGCCGCGACCGATGGGGTCTACCAGCGCGCGCTGGAGAGCGTGCTGCTGCCGCAGGCGGCGCAGCGCA
TCGAGCAGTCGCTGCGCGATGCCGCGAAGATCGATGCCGAGTACAGCTACGAGGCGCTCAAGGCCTACCT
CATGCTGTACGACGCCGAGCGCTACGACGCCGACTTCCTGCAGGCATGGCTGCTCACCGACGTGGACCGC
AAGATCGGCGCCTCGCTCACGCGCGAGCAGCGCACCAACCTCGAGTCGCACCTGAAGGCGTTGTTCGCGG
GGCGCGTGGTGACATCGCCATTCGCCAAGGACGACAAGCTCATCACGCAGACGCGCGAGCGCCTGGCCGG
CGTGCCGCTCGCGCAGCGCTCGTATGCGCGGCTGCGCCGCATCCTGCTGCAGACCAGCCCGCCCAATGCC
TTCACCATCGCCGAGATGGCTGGGGCCGAGTCGGCGCTGGTGATCCGGCGCGCGAGCGGCAAACCGCTGA
CCGACGGCATCCCCACGCTATTCACCTACCGCGGCTACTGGGACATCTTCGACAAGCGAATGGCCGAAAC
CACGCTCGCGCTCGAACAGGAAGACCGTTGGGTGCTGCAGATCCGTGCGCCCGGCATGACCGACATCACC
TCGCGCGAGTTGCTGCTGCGCGAAGTGCGGCGCCTCTACCTCACCGACTACATCCGCGTGTGGGACGAGT
ACCTGGCCGACGTGCGATTGGCCGAAAGCAAATCGCTGCTGCAGAGCATTCAGATGACGCGCGTGCTCTC
GACCGGCGAATCGCCGATGTCGCGGCTCATCCGCGGTGCCGCGCGCGAAACCGATCTGCTGCGCAACCAC
GACGAGGCCGCGCGCAGCCTGCTCGACCAAGCGCAGAACCGGGTGGCCAGCACGCGCGAGCGCATCGAAC
AGCTCATCGGCCAGCCCGACGGCAGCCAGCGCCGCAACGCCGCGCCCGACCGCCCCGAGTCGCTGGTGGA
CAACCACTTCGAGCCGCTGCGCCGGATGGTGACCGCGCCCAAGGCGGGCGGGCAGACGCCGCTGGATGCC
ACGGCGGCGCTCATCAACGAGCTCTACACCTTCCTCACCGCCACCGACACGGCGCTGCGCAGCGGCAACA
TTCCGCCGTCGAGCGATGCCGTCACCAAGGTGCAGGCCGAGGCGGGCCGGCTGCCGGTGCCGTTCCAGGG
GATGCTGAACGACCTGTCGGCCACCGCGTCGTCGAAGGCGGCGGCGGTGACGCGGCAGAACATCGGGCAG
AACGCGGCGGCGACCATCGGGCAGTTCTGCAACCAGGCGATTGCGGGGCGCTACCCGTTCTCCCGCGGCT
CGCCGCGCGACGTGGCGGCCGGCGACTTTGCGCAACTCTTCGCACCGGGCGGGATGATGGACGACTTCTT
CCAGAAGAACCTCGCCTCGCAGGTCGACACTTCGGTCAATCCGTGGACCTTCAAGCGCGGTGTCGACGGC
AGCGCCGCGGGGCGCTCGGCGTACCTCGATTCGTTTCAGAAGGCGCAGGCGATCCGCGACGTGTTCTTCA
CCGGCATGGCGGGCAGCCGCACGCCGTCGTTCACCATCGACCTTCGGCCCGAAGACATGGACGCCGCCAT
CACGCAGTTCACGCTCGACATCGACGGCCAGACGGTGCGCTACGCACACGGCCCACAGGCGCCGAGCACC
GTCAAGTGGCCAGGCCCGCGCAACAGCAACCAGGTGCGCCTGCAGGTGACGACCGCCAACGGCACGCCGG
CCGGCGGCATCGTGACCGAAGGGCCGTGGGCGCTGCACCGCCTCTTCGACAAGGCATCGATCTCGGCCGG
GCGTTCGCCCGAGTCGTTCAACGCGACCTTCGACCTGCAGGGCAAAAAGGTGGTGCTGGCGGTCACGGCC
AACAGCGTCTACAACCCGCTGCGGCTCAACCAGATGAGCGGGTTCTCGTGCCCCGGGAAGTCATAG
 Primer design