SecReT6
Protein ID: 319793926
SecReT6 ID419
T6SS typei3
Gene symbol-
Locus tagVarpa_3270
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]3519276..3523274 [-]
Producttype VI secretion protein icmf
NoteTssM
UniProt IDE6VB06
KEGG IDvpe:Varpa_3270
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 9.30E-86, Aligned region: 589..911
ImcF-related_N [PF14331], Evalue: 5.20E-83, Aligned region: 261..542
DUF1215 [PF06744], Evalue: 1.80E-19, Aligned region: 1028..1139
Protein Sequence: 1332 a.a.     [Download]
>gi|319793926|ref|YP_004155566.1| type VI secretion protein icmf [Variovorax paradoxus EPS]
MQYLKQFLAFLFSRQMLAFVAMVLLALAIWFVGPLLAVDGLRPLASVGVRVAFIVLLLVLGILWLVSGPY
SLVGVAALCLLLWHAGPLLDIGAVKPLASVGVRVAIIGAILLLYALSWLYRFWQALRNNEDLLAKVLSFG
KDAGKDETAKEEIKTVTAAVHRALAQLKGLRGRGGLRRLFEGNRYLYELPWYMVIGSAGAGKTTALLNAG
LQFPLARQMGNASKRVVFKSEGGTLHCDWWFANEAVFIDTAGRYTTQERNPATDPVEWRAFLGLLRKHRT
RAPLNGVIVALDAGEMLTMTEMERAEHASLVHDRLTDLRQELGIRFPVYVVVTKMDLLRGFSEYFQSLTS
EGRMQAWGFALPFHGIKNTRAGTQARDSLRTQMDKELALLNDRLAEGLRARLNEEFDVERRKRLFALPKE
LAALAVPLVPMLDQIFLVSRFDRTQLHDTLRGVYFTSGAQAHAEVPADHQTLVQRLQSSLGPSSSSGLQA
AGTSPEQGQQGFFLQELLTKVIIPEAHLVRPNLRWEFRFRLLRLMGHALALVIFIWLAGALAVSFGNNRR
YLDTVSQRTDVLAGQVSALFGSFKPSGVPDVLNGARELPGYAGLDIDSPPGSFRYGLYSVPPVLAVTADT
YAQLQDHTLLPTILQRMEAVLTQSMKDGDAKAAYETLRVYKLLHDKDRYMKGGARDVSNWVLKDWEHADS
AAAFGGRASMAGHATALFSGERPVQSASLPNEALVRAVQDFLNSNTSTQRVYERAKAAMLREAPQEFTLV
RAVGPQAGTVFSRAGGLPLEKGVPGLFTYDGYHDVFSKRLPEFVGQAIDDDAWVMGRNASAVLDAAARKL
QNDPFLDDIRRQYLSEYAQHWESFLESIRTVGGSDTTGTSLGFDLSVLRQFAAPDSPLARLARAAARETT
LSRPLVVRAQEEKGFLDKASDELNKQTSAIGRNLGIRAEERLEKEIVDNRFAALREVVTGQPDIGAASAG
ATGAKPGLETISGLVNEFYTLLVVADTALTAGSLPPGGSEVGSRLKLEAGKLPAPFREVLTALATSGGDK
VALGSTGILRNQAQQQLDRIMGLMAMQVSEPCKRGVEGRYPLAAVAQDASIEDFTLVFAASGAADEFFNK
YLASYVDTSVRPWRYKDPNVAQAVAGAEGVAGGVAPAPATPGPTLLGELLKLLAQSGPNLDAFYRAQQIR
DLFFRDAGGKKLAWKMDLRVLELEPSITDLIIDIDGQGQRYIHGPVQAFTVHWPGPRGGAMAEITANPRI
SGPTSTLLASGPWALFRLLEKGRIVNTATPGRLSVEYSFDGRKALIDINSGSQPNPLNSDVLKGFRCPGR
AA
 
Nucleotide Sequence: 3999 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c3523274-3519276 Variovorax paradoxus EPS chromosome, complete genome
ATGCAATACCTCAAACAGTTCCTGGCATTTCTTTTTTCCCGGCAGATGCTGGCTTTCGTCGCCATGGTGC
TGCTGGCGCTGGCGATCTGGTTCGTCGGTCCCTTGCTTGCCGTGGATGGACTGCGTCCGCTGGCTTCGGT
CGGCGTGCGCGTGGCCTTCATCGTGCTGCTGCTGGTGCTTGGCATCCTCTGGCTCGTTTCGGGGCCGTAC
AGCCTGGTCGGGGTGGCAGCGCTGTGCCTGTTGCTCTGGCACGCGGGGCCCTTGCTAGATATTGGTGCTG
TAAAGCCGCTCGCATCGGTCGGGGTGCGCGTGGCGATCATTGGCGCGATCCTGCTGCTGTACGCGTTGTC
CTGGCTCTATCGCTTCTGGCAGGCCTTGCGCAACAACGAGGACCTGCTCGCGAAGGTCCTGAGCTTCGGG
AAGGACGCGGGCAAGGACGAGACGGCCAAGGAAGAGATCAAGACGGTCACCGCCGCCGTCCATCGCGCCT
TGGCGCAACTCAAGGGCCTGCGCGGGCGCGGTGGATTGCGTCGCCTGTTCGAAGGCAATCGCTATCTGTA
CGAACTGCCCTGGTACATGGTCATCGGCAGCGCCGGCGCGGGGAAAACCACGGCGCTGCTCAACGCCGGG
CTGCAGTTTCCCCTGGCGCGCCAGATGGGCAATGCGTCGAAGCGCGTGGTGTTCAAGTCTGAAGGGGGCA
CGCTGCATTGCGACTGGTGGTTTGCCAACGAGGCCGTGTTCATCGACACAGCAGGCCGCTACACCACGCA
GGAGCGCAATCCTGCAACCGATCCGGTCGAGTGGCGCGCTTTCCTCGGCCTGCTTCGCAAGCACCGCACG
CGTGCGCCGCTCAATGGCGTGATCGTCGCGCTCGATGCAGGCGAGATGCTGACCATGACCGAGATGGAGC
GTGCCGAGCATGCGAGCCTGGTGCACGACCGCCTGACCGATCTGCGCCAGGAATTGGGCATCCGCTTTCC
CGTGTATGTGGTCGTCACGAAGATGGATCTGTTGCGGGGATTCAGCGAATACTTTCAATCGCTCACCAGC
GAAGGGCGCATGCAGGCCTGGGGCTTCGCGCTGCCATTCCACGGCATAAAGAACACGCGGGCCGGAACGC
AGGCCCGAGACAGCCTGCGCACGCAGATGGATAAGGAGCTCGCATTGCTCAACGACCGGTTGGCCGAGGG
GCTCCGTGCGAGGCTGAATGAGGAGTTCGACGTCGAGCGCCGCAAGCGCTTGTTTGCACTGCCCAAGGAA
CTGGCCGCCTTGGCTGTGCCGCTGGTGCCGATGCTGGACCAGATCTTTCTCGTCTCGCGCTTCGACAGGA
CCCAGTTGCACGACACGCTGCGCGGCGTGTACTTCACGAGCGGTGCGCAAGCTCATGCGGAGGTGCCCGC
CGACCACCAGACGCTGGTCCAGCGACTGCAGAGCAGCCTCGGCCCGTCGTCATCTTCGGGTCTGCAAGCC
GCGGGCACGTCGCCCGAACAGGGGCAGCAAGGATTCTTTCTCCAGGAGTTGCTGACCAAGGTCATCATCC
CGGAAGCCCATCTGGTGAGGCCCAATCTGCGCTGGGAATTTCGGTTCCGGCTGCTGCGCCTGATGGGGCA
CGCCCTGGCGCTCGTGATCTTCATCTGGCTGGCCGGTGCGCTGGCCGTGAGCTTCGGCAATAACCGTCGA
TACCTGGACACTGTCAGCCAGCGTACCGATGTACTCGCGGGTCAAGTGAGCGCGCTGTTCGGCAGCTTCA
AGCCATCTGGCGTACCGGATGTGCTGAACGGCGCGCGCGAGTTGCCCGGCTATGCGGGGCTGGACATCGA
CAGCCCGCCGGGCAGCTTTCGCTATGGCCTGTACAGCGTGCCGCCAGTGCTGGCTGTGACTGCCGACACC
TACGCCCAGCTGCAGGACCACACCTTGCTCCCGACCATCCTGCAGCGCATGGAGGCCGTGCTGACGCAGA
GCATGAAGGACGGCGATGCGAAGGCCGCCTATGAAACCCTGCGCGTCTACAAGCTCCTGCACGACAAGGA
CCGGTACATGAAAGGAGGCGCTCGGGACGTCAGCAACTGGGTTCTCAAGGACTGGGAGCATGCCGACAGT
GCCGCCGCCTTTGGCGGGCGCGCTTCGATGGCAGGCCATGCCACGGCACTCTTTTCCGGCGAGCGTCCGG
TGCAGTCGGCATCGCTGCCCAACGAGGCGCTCGTGCGTGCGGTGCAGGACTTCCTGAACAGCAACACCTC
GACGCAACGCGTCTACGAACGCGCCAAGGCGGCGATGCTGCGCGAAGCCCCCCAGGAGTTCACATTGGTC
CGGGCGGTCGGGCCGCAAGCCGGCACCGTGTTCTCCCGTGCCGGCGGCCTGCCTCTCGAGAAAGGCGTGC
CGGGCCTTTTCACCTACGACGGATACCACGACGTCTTCAGCAAGCGGTTGCCGGAATTCGTCGGGCAGGC
CATTGACGACGACGCATGGGTGATGGGGCGCAATGCTTCAGCGGTGCTCGATGCTGCTGCCCGAAAATTG
CAGAACGATCCGTTCCTCGACGACATCCGTCGCCAGTACCTGAGCGAATATGCCCAGCACTGGGAATCCT
TTCTCGAATCGATTCGCACGGTCGGGGGCAGCGACACCACCGGCACCAGCCTGGGGTTCGACCTGAGCGT
GTTGCGGCAGTTCGCCGCGCCCGACTCGCCGCTGGCGCGGCTGGCGCGCGCGGCGGCACGCGAGACCACG
CTGTCGCGTCCGCTGGTCGTGCGTGCCCAGGAGGAAAAGGGGTTCCTCGACAAGGCTTCCGATGAACTGA
ACAAGCAGACCAGCGCGATCGGCAGGAACCTCGGCATTCGCGCGGAGGAACGACTCGAAAAGGAAATCGT
CGACAACCGCTTTGCCGCGTTGCGCGAAGTGGTGACGGGCCAGCCGGATATCGGTGCTGCAAGCGCTGGA
GCCACCGGCGCCAAGCCGGGGCTCGAAACAATCTCGGGCCTCGTCAACGAGTTCTACACGCTGCTTGTCG
TGGCCGATACGGCGCTGACTGCAGGAAGCCTTCCACCCGGAGGCTCCGAAGTCGGTTCGCGGCTGAAGCT
GGAGGCCGGAAAGCTCCCGGCGCCGTTTCGCGAGGTGCTGACCGCATTGGCCACGAGCGGCGGCGACAAG
GTGGCGCTCGGTTCCACAGGCATCCTGCGCAACCAGGCCCAGCAGCAGCTCGATCGCATCATGGGCCTGA
TGGCGATGCAGGTCAGTGAACCGTGCAAGCGTGGCGTGGAAGGGCGCTATCCGCTGGCCGCGGTGGCGCA
GGACGCATCGATAGAAGACTTCACGCTGGTCTTCGCCGCGAGCGGCGCCGCGGACGAGTTCTTCAATAAG
TACCTGGCTTCCTACGTCGATACCAGCGTGCGTCCATGGCGCTACAAGGATCCGAATGTGGCCCAGGCCG
TTGCCGGTGCCGAGGGTGTTGCCGGCGGAGTGGCACCGGCTCCCGCGACCCCAGGGCCGACATTGCTTGG
CGAACTGCTCAAGCTGTTGGCGCAAAGCGGGCCGAACCTCGATGCCTTCTATCGCGCCCAGCAGATCCGC
GACCTTTTCTTCCGCGATGCGGGCGGCAAGAAACTCGCTTGGAAGATGGACCTGCGGGTGCTCGAACTGG
AGCCCAGCATCACCGATCTGATCATCGACATCGACGGGCAGGGCCAGCGCTACATCCATGGCCCGGTGCA
GGCGTTTACCGTTCATTGGCCTGGGCCGCGTGGCGGTGCAATGGCGGAGATCACGGCCAATCCGCGCATC
TCGGGACCTACCTCGACCCTTCTGGCCAGTGGTCCATGGGCGTTGTTCCGATTGCTTGAAAAGGGTCGCA
TCGTGAACACGGCGACGCCGGGGCGGCTGAGCGTCGAATATTCGTTCGACGGTCGCAAGGCGTTGATCGA
CATCAACTCGGGCAGCCAGCCCAACCCGCTCAACAGCGATGTGCTCAAGGGCTTCCGCTGCCCGGGTCGA
GCGGCATGA
 Primer design