SecReT6
Protein ID: 319796168
SecReT6 ID420
T6SS typei4b
Gene symbol-
Locus tagVarpa_5542
StrainVariovorax paradoxus EPS
Repliconchromosome [GenBank: NC_014931] [Browse all T6SS(s) in this replicon]
Location [Strand]6031645..6035490 [-]
Producttype VI secretion protein icmf
NoteTssM
UniProt IDE6VAF3
KEGG IDvpe:Varpa_5542
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.50E-72, Aligned region: 186..435
IcmF-related [PF06761], Evalue: 4.20E-49, Aligned region: 493..852
DUF1215 [PF06744], Evalue: 8.20E-31, Aligned region: 981..1099
DUF3007 [PF11460], Evalue: 0.0062, Aligned region: 13..93
DUF3007 [PF11460], Evalue: 0.0062, Aligned region: 448..468
Protein Sequence: 1281 a.a.     [Download]
>gi|319796168|ref|YP_004157808.1| type VI secretion protein icmf [Variovorax paradoxus EPS]
MRRFFSFLADPRTLSVIGAIALGAFLLIGAQTLEIGAIWAVGIFAVLLLLWLLVWFIRRMRTRSANRKLG
DMLEDQADAAVRDSDPERKAEIDELRGRMVEAVKTIKTSKIGQMSGSEALYELPWYMVIGNPAAGKSSAI
LNSGLQFPFADKGNAVIQGIGGTRNCDWFFTTEGIVLDTAGRYSIHQEDRKEWFGFLDLLKKYRPKAPIN
GIIITASIPELIGSRPDFAIQLAKNLRQRMQELTERLEVFAPVYVMFTKADLITGFAEFFGDSDKMERDR
VWGASLPYDGDEKQDAVALFDKRFDELYLGLKEISVSHFASHRGSDPSPELLIFPLEFAAIKPALRAFLA
TLFESNPFQHKPVFRGFYFTSALQEGTMRSLSTERIAKRFGLTLNNAASKSKEIYSQNGFFLRDLFSKVI
FADKKTVRQFSSPVKARVRYVSFFAFVAVLGLLLGGWTWSYLGNRQLVENVQADLDKVVKLQASDNGLRT
RFEALGILQDRIEQLEKFRNDRPLSLSLGLYQGNQLEDKLVAEYYGGVKQLMLAPVSDNLQAFLREVNAH
PERLRRADAAGNPAAPVAVSAATPATPPAAESGGLYAGSSPADVQDAYNALKTYLMLSDKRQVETAHLTD
QISRFWRGWLESNRGDMPRAAVIRDAERMITFYLRRVGDDNWPALADTNLALVEQTRDNLRRVVRGMPAR
ERVYAEIKARASTRFAPMTVARILGATAGAESEGTIAGSVAISGAFTREAWQQYVDDAIRDAANKETSSK
DWVLNVAGNDDLTLEGSPEQIRKTLATMYKLEYAKEWQRFLQGIAVKDMGSFEQAVVAMNLLGDPQNSPI
RKVFDTVYDQTSWDNPSLVNAGLQQARTGALNWFKNLFSRATPSQVNVNIDASGNRTEIPMGPIGREFAG
VARLVVERDNTSLLRGYLGTLSKLRGRFNQIKNQGDPGPGARQLMQQTLEGNGSELADALKYVDEQMLTG
MDASQRQALRPLLVRPLLQAYAVTIQPTAVEVNKIWSAQVHQPFQQSLATKYPFAAGAKIEASPAEIAQF
FGPEGAIGKFVTTTLGSLVIRRGDLLSPRAWGDQGLTLSPDFVNGFSQWVAPLSGAAAGGGAGAAQPQTL
FQILPQPVSGLTEYMVEIDGQQLRYRNTPPQWSNFVWPNAQGTPGARITAVTFDGRTVELINEPGNFGLE
RLLSTAQRTKLPDGSFELTWARDNASVTVKLRVIQNTQSGGTGGDSPQGKGLRGTVLPSSVAEIGVPAQS
RATPAATAPGAPATSAQGVGK
 
Nucleotide Sequence: 3846 bp     [Download]
>gi|319790694|ref|NC_014931.1|:c6035490-6031645 Variovorax paradoxus EPS chromosome, complete genome
ATGCGGCGATTCTTCAGTTTCCTGGCCGATCCGCGCACCCTCTCGGTGATCGGCGCCATCGCGCTCGGCG
CGTTCCTCCTGATCGGCGCGCAGACGCTCGAGATCGGCGCGATCTGGGCGGTCGGCATCTTCGCCGTGCT
GCTGCTGTTGTGGCTGCTCGTGTGGTTCATCCGGCGCATGCGCACCCGCTCGGCCAACCGCAAGCTCGGC
GACATGCTCGAAGACCAGGCCGATGCCGCCGTGCGCGACAGCGATCCCGAGCGCAAGGCCGAGATCGACG
AGCTGCGCGGGCGCATGGTCGAGGCGGTCAAGACCATCAAGACGTCCAAGATCGGGCAGATGTCGGGCAG
CGAGGCGCTGTACGAGCTGCCCTGGTACATGGTCATCGGCAACCCGGCGGCGGGCAAGAGCAGCGCCATC
CTGAATTCGGGCCTGCAGTTCCCGTTCGCCGACAAGGGCAACGCGGTGATCCAGGGCATCGGCGGCACGC
GCAACTGCGACTGGTTCTTCACCACCGAAGGCATCGTGCTCGATACCGCGGGCCGCTATTCGATTCACCA
GGAAGACCGCAAGGAGTGGTTCGGCTTTCTCGACCTGCTCAAGAAGTACCGGCCGAAGGCGCCGATCAAC
GGGATCATCATCACGGCGAGCATTCCCGAGCTGATCGGCAGCCGGCCCGATTTCGCGATCCAGCTTGCGA
AGAATCTGCGCCAGCGCATGCAGGAGCTGACCGAGCGGCTCGAGGTGTTCGCACCGGTCTACGTGATGTT
CACCAAGGCCGACCTGATCACCGGCTTTGCGGAGTTCTTCGGCGACAGCGACAAGATGGAGCGCGACCGC
GTGTGGGGCGCATCGCTGCCCTACGACGGCGACGAGAAGCAGGACGCGGTGGCCCTGTTCGACAAGCGCT
TCGACGAGCTCTACCTGGGCCTGAAGGAAATCAGCGTCTCGCACTTCGCGAGCCACCGCGGCAGCGATCC
GTCGCCCGAGCTCCTGATCTTTCCGCTCGAATTCGCAGCCATCAAGCCCGCGCTGCGCGCCTTCCTCGCC
ACGCTGTTCGAGAGCAATCCGTTCCAGCACAAGCCGGTGTTCCGCGGCTTCTACTTCACCAGCGCATTGC
AAGAGGGCACGATGCGCAGCCTGTCGACCGAGCGCATCGCCAAGCGTTTCGGGCTCACGCTGAACAACGC
GGCCAGCAAGTCCAAGGAAATCTATTCGCAGAACGGATTCTTCCTGCGCGACCTGTTTTCCAAGGTGATC
TTTGCCGACAAGAAGACGGTGCGGCAGTTCTCCAGCCCGGTGAAGGCCCGCGTGCGCTACGTGAGCTTCT
TTGCCTTCGTCGCCGTGCTGGGGCTGCTGCTCGGCGGATGGACCTGGTCGTACCTGGGCAACCGGCAGCT
GGTGGAGAACGTGCAGGCCGACCTCGACAAAGTGGTCAAGCTGCAGGCCAGCGACAACGGGCTGCGCACG
CGCTTCGAGGCACTGGGCATCCTGCAGGACCGCATCGAGCAACTCGAGAAATTTCGCAACGACCGTCCGC
TGTCGCTCTCGCTCGGCCTCTACCAGGGCAACCAGCTCGAGGACAAGCTCGTCGCCGAGTATTACGGCGG
CGTCAAGCAGCTGATGCTCGCGCCGGTGTCCGACAACCTGCAGGCGTTCCTTCGCGAGGTCAACGCGCAT
CCGGAACGGCTCCGGCGTGCCGATGCAGCGGGCAACCCTGCCGCGCCGGTCGCTGTGTCGGCCGCCACGC
CGGCAACGCCGCCCGCTGCAGAGAGCGGCGGCCTGTATGCGGGCTCGTCGCCGGCCGATGTGCAGGACGC
CTACAACGCGCTCAAGACGTATCTCATGCTGTCCGACAAGCGTCAGGTGGAGACCGCGCACCTCACGGAC
CAGATATCGCGCTTCTGGCGCGGCTGGCTCGAAAGCAACCGTGGCGACATGCCGCGCGCCGCGGTCATCC
GCGACGCCGAACGCATGATCACTTTCTACCTGCGCCGCGTGGGCGACGACAACTGGCCCGCGCTGGCCGA
CACCAACCTCGCACTGGTCGAGCAGACGCGCGACAACCTGCGCCGCGTGGTGCGCGGCATGCCGGCGCGC
GAGCGGGTGTATGCCGAGATCAAGGCGCGTGCCTCCACACGCTTCGCTCCAATGACGGTGGCGCGCATCC
TGGGCGCGACGGCCGGCGCCGAGAGCGAGGGCACCATCGCCGGCAGCGTCGCCATCTCGGGCGCGTTCAC
GCGCGAGGCCTGGCAGCAGTACGTGGACGACGCCATCCGTGATGCCGCCAACAAGGAAACATCGAGCAAG
GACTGGGTGCTCAACGTCGCGGGCAACGACGACCTGACGCTCGAAGGCAGCCCCGAGCAGATCCGCAAGA
CGCTCGCCACCATGTACAAGCTGGAGTACGCCAAGGAGTGGCAGCGCTTCCTGCAGGGCATCGCGGTCAA
GGACATGGGCAGCTTCGAGCAGGCCGTGGTGGCGATGAACCTGCTGGGCGATCCGCAGAACTCGCCGATC
CGCAAGGTCTTCGACACCGTCTACGACCAGACCTCGTGGGACAACCCATCGCTGGTCAATGCCGGCCTGC
AGCAGGCACGCACCGGGGCGCTGAACTGGTTCAAGAACCTCTTCAGTCGCGCCACGCCTTCGCAGGTCAA
CGTGAACATCGACGCGAGCGGCAACCGCACCGAGATTCCGATGGGCCCGATCGGCCGGGAATTCGCGGGC
GTCGCGCGCCTGGTGGTCGAGCGCGACAACACCTCGCTCCTGCGCGGCTACCTCGGCACGCTGTCGAAGC
TGCGCGGGCGCTTCAACCAGATCAAGAACCAGGGCGACCCCGGACCGGGCGCGCGCCAGCTGATGCAGCA
GACGCTGGAAGGCAATGGCTCCGAGCTGGCCGATGCGCTCAAGTACGTCGACGAGCAGATGCTCACCGGC
ATGGACGCGTCGCAGCGCCAGGCCCTCCGGCCTTTGCTGGTTCGGCCGCTGCTGCAGGCCTATGCGGTGA
CGATCCAGCCGACGGCGGTGGAGGTCAACAAGATCTGGAGCGCGCAGGTGCATCAGCCGTTCCAGCAGTC
GCTCGCGACCAAGTACCCGTTCGCCGCGGGCGCGAAGATCGAGGCTTCGCCGGCGGAGATCGCGCAGTTC
TTTGGTCCCGAAGGCGCCATCGGCAAGTTCGTGACGACGACGCTGGGCTCGCTGGTCATCCGCCGCGGTG
ACCTGCTCTCGCCGCGCGCCTGGGGCGACCAGGGCCTCACGCTGAGTCCCGATTTCGTCAACGGCTTCTC
GCAATGGGTCGCGCCGCTGTCGGGCGCCGCGGCTGGCGGAGGCGCCGGTGCCGCGCAGCCGCAGACGCTG
TTCCAGATCCTGCCGCAGCCCGTCTCGGGCCTGACGGAATACATGGTCGAAATCGATGGCCAGCAGCTGC
GCTACCGCAACACGCCGCCGCAGTGGTCCAACTTCGTGTGGCCCAACGCGCAGGGCACGCCGGGCGCGCG
GATCACCGCCGTCACCTTCGACGGGCGCACCGTCGAGCTCATCAACGAGCCGGGTAATTTCGGGCTGGAG
CGGCTGCTCAGCACGGCCCAGCGCACGAAGTTGCCGGACGGCAGCTTCGAGCTCACCTGGGCGCGCGACA
ACGCGAGCGTGACCGTCAAGCTGCGCGTGATCCAGAACACGCAGTCGGGCGGCACGGGCGGCGATTCGCC
GCAAGGCAAGGGGCTGCGCGGCACCGTGCTGCCTTCGTCGGTGGCGGAGATCGGCGTGCCTGCGCAATCG
CGCGCAACGCCTGCGGCAACGGCACCGGGGGCACCGGCGACATCGGCACAGGGAGTTGGCAAATGA
 Primer design