SecReT6
Protein ID: 320106312
SecReT6 ID504
T6SS typei4b
Gene symbol-
Locus tagAciPR4_1077
StrainTerriglobus saanensis SP1PR4
Repliconchromosome [GenBank: NC_014963] [Browse all T6SS(s) in this replicon]
Location [Strand]1280310..1283738 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDE8UX21
KEGG IDtsa:AciPR4_1077
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.40E-45, Aligned region: 492..795
ImcF-related_N [PF14331], Evalue: 1.20E-35, Aligned region: 184..444
ImcF-related_N [PF14331], Evalue: 1.20E-35, Aligned region: 733..794
DUF1215 [PF06744], Evalue: 3.30E-15, Aligned region: 883..998
Protein Sequence: 1142 a.a.     [Download]
>gi|320106312|ref|YP_004181902.1| ImcF domain-containing protein [Terriglobus saanensis SP1PR4]
MVYLFAFLFVAVSAILAWLAGPLLHLHGTGLLVVRIVLLILGIAAAIAVLFFQRSLKFFQTRDANPHDSA
ELNTLLRDAQRHLSSSQRAVAKSFASTPLLYLLGGSNSAKTTTVLRSGLDPELLAGEVYRDQTVASTSRA
NLWHTGENVIVEVGETVRKSPQLWKLLLSVTRPRIYQSALGKKPPSRAVIVCTSCESFFGPDAATSLTTL
ARETNGMLRTLARQLGTDLPVYVLLTKLDRIPGFAEFVRHLSTEEISEPLGIALPRHAASSRFYAEEVTR
SVSSSLDQLLFSLGQFRVEALARQAGQNTTAPVYEFPREMAKLRNNLISYLIELTRPSHLSANPHLYGFY
FTGVRAHLSEQAVSAPAAVRRQAQIDAEATGIFSLKSLAANGPQPVAPIVTQRIAQWCFLPHLFTDVIFA
DRHALAGDQNSKRVHLVRRLLLATVSLFLLICGIGLTLSYRNNARLEREIQESEVALPSGGPVETLASTS
QLASLDRLRSTLAELEGYEQNGAPMMFRWGLFHGDSLIAPARRLYFDRFQQLLLASTQKHLVANLGALPA
TAPADADYFAAYNSLRAYLITTSNPEKSTADFLPPVLTRFWLNGQHQESDLQSELAGRQFTFYAEELRRA
DPFHIAPAMPAVAEARLYLDSFGGFDRVYQNMIAAANQVALAVDFNRLYPGSAATVVEPHVVPGAFTRDG
FAYVQKALQHPDHFLRGEDWVLGTQTAPSMQLAQLAQKLTERYDTDFTAQWHIFLHSATIVRYRNLQDAQ
QKLQSLSSPNSSLLALIFTASHHTAVASPTVAHQFQPVQVMVPPDSINRFIAGSNSGYINGLIGLQGALS
QFNQDTTAATNPAATQPIVSAAVAAHAAVGQTSQSFNIDPQAHVEQMVISLLQTPITSVEDTIRGERPQQ
TNLAGHGFCSNVATLTAKYPFSRGATVEATAAEITSMFKPGSGALWVFYDATLKPLIIQQGSTWVAAPTA
PIKPTAAFLQFFNRMATISNALFPAGATAPTLTFNTHILRSKEIQSVTFTVDADRLTGAEVSRGFTWSAQ
NAQKAELIANYGSGTLPLQFSGTWSLFHLLDRGKLEQGGNPARFAYPLEISNTPIVIKGTPLTERFEISG
PGASLLIPGALTGLHCAAQIAH
 
Nucleotide Sequence: 3429 bp     [Download]
>gi|320105246|ref|NC_014963.1|:c1283738-1280310 Terriglobus saanensis SP1PR4 chromosome, complete genome
GTGGTTTATCTTTTCGCCTTTCTCTTCGTCGCCGTCTCCGCGATTCTCGCGTGGCTTGCGGGACCGTTGC
TTCACCTTCATGGGACTGGACTGCTTGTCGTTCGCATCGTCCTTCTGATCCTTGGCATCGCAGCAGCAAT
TGCGGTGCTGTTCTTTCAGCGAAGCCTGAAGTTCTTTCAGACTCGCGATGCAAACCCCCATGACAGCGCG
GAACTAAACACGCTCCTGCGCGATGCGCAACGTCATCTCAGTTCTTCGCAGCGGGCTGTTGCCAAATCGT
TTGCCTCCACGCCCCTGCTCTACCTCCTCGGCGGCTCCAACTCTGCCAAGACAACAACCGTTCTCAGATC
CGGTCTCGATCCTGAACTGCTTGCTGGGGAGGTATATCGCGATCAAACGGTGGCCTCGACCTCGCGCGCA
AACCTCTGGCATACCGGAGAAAACGTGATCGTCGAAGTGGGCGAGACCGTTCGCAAAAGCCCTCAACTGT
GGAAGCTCCTGTTGAGCGTGACCAGACCCAGAATTTACCAATCGGCATTGGGCAAAAAACCGCCATCCCG
TGCAGTGATTGTGTGTACGAGTTGCGAATCTTTTTTCGGTCCAGATGCCGCAACCTCCCTAACAACCCTT
GCCCGCGAAACAAACGGCATGCTCCGGACGCTCGCACGTCAACTCGGAACCGACCTCCCTGTCTATGTTC
TGCTGACGAAACTCGACCGGATTCCTGGCTTCGCCGAGTTCGTGCGCCATTTGTCCACGGAAGAGATCTC
CGAGCCTTTGGGCATTGCGCTCCCACGTCATGCAGCCTCGAGCCGCTTTTATGCGGAAGAAGTGACCAGG
TCGGTTTCGTCCTCTCTTGATCAGCTTCTCTTCTCGCTCGGCCAGTTCCGCGTGGAGGCGCTCGCGCGCC
AGGCCGGTCAGAACACCACAGCTCCTGTCTATGAGTTTCCCCGGGAGATGGCCAAGCTTCGCAACAACCT
GATCTCATATTTAATCGAACTTACCCGCCCCAGCCACCTGAGCGCCAATCCTCACTTATATGGTTTCTAC
TTCACAGGTGTGCGTGCGCACCTCTCGGAACAGGCAGTCAGTGCCCCTGCAGCCGTACGTCGGCAGGCAC
AGATCGATGCCGAAGCAACTGGCATTTTTTCCCTTAAAAGCCTGGCAGCCAACGGCCCGCAGCCCGTGGC
TCCAATCGTCACGCAAAGGATCGCGCAGTGGTGCTTCCTGCCTCACTTATTTACAGACGTAATTTTTGCC
GACCGACATGCGCTCGCTGGCGATCAAAACAGCAAGCGCGTTCATCTCGTGCGTCGACTGCTGCTTGCCA
CTGTCTCCCTCTTTCTCCTGATTTGCGGCATCGGTCTTACTCTCTCTTACCGCAACAATGCGCGCCTTGA
ACGGGAGATTCAGGAGAGTGAAGTGGCTCTGCCGTCCGGCGGGCCAGTCGAGACGTTGGCATCTACTTCA
CAGCTGGCAAGTCTCGACCGACTTCGTTCCACCCTCGCGGAATTAGAAGGATACGAACAAAATGGAGCGC
CCATGATGTTCAGATGGGGACTCTTCCATGGTGATTCGCTCATCGCCCCCGCACGCCGTCTCTACTTTGA
CCGGTTTCAGCAACTGCTGCTCGCGAGCACGCAGAAGCATCTCGTCGCGAATCTTGGCGCTTTGCCTGCT
ACCGCGCCAGCTGACGCGGACTATTTTGCCGCCTATAACTCCCTTCGCGCTTATCTGATCACCACATCCA
ACCCGGAGAAGAGCACAGCAGATTTCCTTCCGCCAGTGCTCACCCGCTTCTGGCTTAACGGCCAACATCA
GGAGTCAGATCTGCAGAGTGAACTCGCCGGACGTCAGTTCACTTTCTACGCCGAGGAGCTTCGACGTGCC
GATCCCTTCCACATCGCGCCAGCCATGCCTGCTGTCGCTGAAGCTCGTTTATATCTGGACAGTTTTGGCG
GATTCGATCGCGTATACCAGAACATGATCGCGGCTGCGAATCAAGTCGCACTTGCAGTGGACTTCAACCG
CCTCTATCCAGGGTCGGCCGCGACGGTAGTCGAGCCGCATGTAGTACCGGGCGCTTTTACTCGCGATGGC
TTCGCTTATGTGCAGAAAGCGTTGCAGCACCCGGATCACTTTCTCAGGGGCGAGGATTGGGTTCTGGGCA
CCCAGACTGCGCCTTCCATGCAGCTCGCTCAACTTGCACAGAAGCTTACGGAGCGCTACGACACGGATTT
CACAGCCCAATGGCACATCTTCTTGCACTCTGCGACAATCGTGCGTTATCGCAACCTGCAGGATGCGCAA
CAAAAATTACAGAGCCTGTCATCACCCAACTCATCGTTACTCGCGCTTATCTTCACCGCTTCGCATCATA
CGGCTGTGGCCAGCCCAACGGTTGCGCACCAGTTTCAGCCAGTCCAGGTCATGGTCCCGCCAGACAGCAT
CAACCGGTTCATCGCTGGCAGCAACAGCGGCTATATCAACGGACTCATCGGTCTCCAGGGCGCTCTCTCT
CAGTTCAATCAGGACACCACCGCAGCCACCAACCCCGCCGCAACCCAACCCATCGTCAGCGCTGCGGTTG
CAGCCCACGCCGCCGTGGGGCAGACATCGCAATCGTTCAACATCGATCCGCAGGCGCATGTTGAGCAAAT
GGTCATCAGCCTGCTGCAGACACCCATCACCTCTGTCGAAGATACGATACGCGGCGAGCGTCCACAACAA
ACCAACCTCGCAGGTCATGGCTTCTGCAGCAACGTAGCGACCTTGACTGCTAAGTACCCCTTCTCGCGCG
GAGCCACGGTCGAGGCTACAGCCGCCGAGATTACCTCGATGTTCAAGCCCGGTTCGGGCGCACTCTGGGT
GTTCTATGATGCAACGCTCAAACCTCTGATCATTCAACAGGGCAGCACGTGGGTTGCGGCACCCACCGCA
CCAATCAAACCCACGGCGGCGTTCCTGCAGTTCTTCAATCGCATGGCGACGATTTCGAACGCGCTCTTCC
CTGCCGGCGCGACCGCTCCGACACTGACTTTCAACACGCATATCCTGCGCTCAAAAGAAATTCAAAGTGT
CACCTTCACTGTCGACGCAGATCGTCTCACCGGTGCTGAGGTCTCGCGCGGTTTTACATGGTCGGCTCAG
AACGCGCAGAAAGCAGAGCTGATTGCGAACTACGGTAGCGGTACTCTGCCTCTGCAATTCAGCGGGACTT
GGTCGCTCTTCCACCTTCTGGATCGCGGCAAACTCGAACAGGGTGGCAATCCGGCACGCTTCGCGTATCC
TCTCGAAATCTCAAACACGCCCATCGTTATCAAGGGCACACCATTAACGGAGCGGTTCGAGATCTCCGGT
CCCGGAGCGAGTCTGCTCATCCCAGGTGCGCTCACTGGCCTACATTGCGCTGCACAGATTGCGCACTGA
 Primer design