SecReT6
Protein ID: 320158745
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03898
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1061250..1063085 [-]
ProductVgrG protein
NoteTssI
UniProt IDE8VUQ5
KEGG IDvvm:VVMO6_03898
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.70E-56, Aligned region: 30..333
Phage_base_V [PF04717], Evalue: 2.90E-26, Aligned region: 377..469
Protein Sequence: 611 a.a.     [Download]
>gi|320158745|ref|YP_004191123.1| VgrG protein [Vibrio vulnificus MO6-24/O]
MKKATQDNKFINISTPYGKDSIILNSFEYREEMSELFSLRAYAYFNGQKGELNQIVGQPVIIKMDNNSQV
MLEPRYFHGFVAKATLAGSRVTKFEDGENYKNIELFVVPKLNFADYKINSRIFQNKDIKEIISLILGEHG
VDFSFSLTKSYAKYNYKVQYEESDLQFVKRLLSEEGLSFCFSHTKSSHVIEIFDDASYYKPGAEFLIDFN
SGTAELGHISSWHEAQSMVITRSHKSGYDMKKPASHPNNTAKGSESLFTVPSSEHYEYLGEAESGDQYKT
RNTHTIESLQQNAYVCSGESSCRSFAVGRSFKFGKHEDPSRIGKEFVLSSIVINAAVFNQVGHGGPSNQG
VRSYFTCIESGKVHRPAVNFVRPVIRGIQTAVVTGNKQGEIYVDKYGRIKVQFHWDREGKFDTTSSCWIR
VAQQIAGNGWGSSFLPRVGQEVIVEFINGDPDQPVVTGSLYNGTQAPPFSLPEKKTQSGYRSQSVEKGAS
NYNELRFEDKPGEEHVYLHAEKNFQMVVEDSADVLVENNKTQKITNNLTEEVGQNVSGKIGKNYSLDIGE
VLSLTAGKSIEIKVGGASIQMSSSGEINIKGNKIAINGASIALKAGQISLN
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1063085-1061250 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGAAAAAAGCGACTCAAGATAATAAATTTATAAATATTTCCACGCCTTATGGGAAAGATTCGATTATTC
TCAATTCTTTTGAATATAGAGAAGAAATGTCAGAGCTATTTTCATTGCGAGCTTATGCTTATTTTAATGG
TCAAAAAGGCGAACTGAATCAAATCGTGGGTCAGCCAGTTATTATCAAAATGGATAATAATAGCCAAGTC
ATGTTGGAACCGAGATACTTCCATGGGTTTGTTGCAAAGGCAACACTAGCAGGAAGCCGAGTGACCAAAT
TTGAAGATGGTGAAAATTACAAAAATATTGAGCTTTTTGTTGTGCCAAAATTGAATTTTGCGGACTACAA
AATCAACAGCCGAATCTTTCAAAATAAAGATATAAAAGAAATCATTTCATTAATTCTTGGTGAGCATGGC
GTCGACTTTTCTTTTTCTCTGACCAAAAGCTATGCCAAGTATAACTACAAAGTTCAGTACGAAGAATCGG
ATCTACAGTTTGTTAAAAGACTCTTATCTGAGGAAGGGCTGTCGTTCTGTTTCAGCCATACTAAATCTTC
ACATGTGATCGAGATATTTGATGATGCCAGCTATTACAAGCCAGGTGCTGAATTTTTAATTGATTTCAAT
TCAGGTACCGCAGAGTTGGGTCATATCTCTTCGTGGCATGAAGCTCAATCGATGGTGATCACGCGCAGTC
ACAAAAGTGGCTATGATATGAAAAAGCCAGCTTCACATCCCAACAATACGGCAAAAGGGAGCGAATCGTT
ATTTACCGTTCCGAGCAGCGAGCATTATGAATATCTGGGTGAAGCGGAGTCGGGTGATCAGTACAAAACG
AGAAATACCCACACGATCGAATCATTACAGCAAAACGCATACGTTTGTTCTGGAGAGTCGAGTTGCCGCT
CCTTTGCTGTCGGCAGAAGTTTCAAATTTGGTAAGCATGAAGACCCTAGCCGAATCGGCAAAGAGTTCGT
GCTCTCATCGATTGTGATCAACGCAGCTGTTTTCAACCAAGTAGGTCATGGTGGCCCTTCAAATCAAGGT
GTTAGGAGTTATTTTACCTGCATTGAGTCAGGGAAAGTGCATCGTCCGGCGGTTAACTTTGTGAGGCCAG
TTATTCGCGGAATCCAAACTGCGGTTGTGACAGGTAATAAGCAAGGTGAAATCTACGTCGATAAATATGG
GCGGATAAAAGTTCAATTTCACTGGGATCGTGAAGGTAAGTTTGATACGACGAGCTCGTGCTGGATACGT
GTCGCACAACAAATTGCAGGGAATGGCTGGGGAAGCTCATTTCTGCCAAGAGTAGGGCAAGAGGTCATCG
TTGAATTTATCAATGGGGATCCGGATCAGCCAGTGGTGACAGGGTCGCTTTACAATGGGACTCAAGCGCC
ACCTTTTTCGTTGCCAGAGAAGAAAACCCAAAGTGGTTACCGTAGCCAGTCTGTAGAAAAAGGGGCGAGT
AACTACAACGAATTACGCTTTGAAGACAAACCGGGTGAGGAACATGTCTATCTTCATGCGGAAAAGAACT
TCCAAATGGTCGTCGAAGATTCCGCTGATGTCCTAGTTGAAAACAATAAGACCCAGAAAATTACCAACAA
CCTAACGGAGGAGGTTGGACAAAACGTCTCTGGGAAGATTGGGAAAAACTATTCACTCGATATTGGCGAA
GTCCTTTCTCTGACCGCAGGCAAAAGCATTGAAATTAAAGTGGGCGGCGCTTCGATTCAGATGTCGAGTT
CGGGGGAGATCAATATTAAAGGCAACAAAATAGCCATTAATGGTGCCTCGATTGCCTTAAAAGCTGGCCA
GATTTCACTGAACTAG
 Primer design