SecReT6
Protein ID: 320158746
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03899
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1063140..1063619 [-]
Producthypothetical protein
NoteTssD
UniProt IDE8VUQ6
KEGG IDvvm:VVMO6_03899
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.90E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|320158746|ref|YP_004191124.1| hypothetical protein VVMO6_03899 [Vibrio vulnificus MO6-24/O]
MQSNTYLKYADIKGEATAEQYKDMITLLSVDWSVGREISSYTGTAMDREASSTRLYDMTITKLQDKASPD
LFKEATIGKGKPAVFHITKQGEKIEEIMKIQLTDAMISNYAVSIQDDRPIETITISYTEMMMTVTPTDDK
NNTSAPLVYGYSGVKGQQM
 
Nucleotide Sequence: 480 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1063619-1063140 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGCAGTCAAATACCTACCTGAAATATGCTGATATTAAAGGTGAAGCTACCGCAGAGCAGTACAAGGATA
TGATTACTCTTCTTTCAGTTGATTGGAGTGTAGGTCGTGAAATTTCTTCTTATACTGGCACCGCAATGGA
TCGTGAAGCAAGCTCTACTCGTCTTTACGATATGACCATTACCAAACTTCAAGACAAAGCATCCCCAGAT
CTGTTCAAAGAAGCCACGATTGGTAAGGGTAAACCCGCTGTATTCCATATCACTAAGCAGGGTGAAAAAA
TCGAAGAAATCATGAAAATTCAACTAACGGATGCCATGATTTCTAACTATGCAGTGTCAATTCAAGACGA
CCGTCCAATTGAAACAATCACCATTTCTTACACAGAGATGATGATGACGGTGACGCCTACTGATGACAAA
AACAACACATCTGCTCCGTTGGTATACGGTTACAGCGGTGTTAAAGGTCAACAAATGTAA
 Primer design