SecReT6
Protein ID: 320158747
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03900
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1063835..1066399 [-]
ProductClpB protein
NoteTssH
UniProt IDE8VUQ7
KEGG IDvvm:VVMO6_03900
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.70E-40, Aligned region: 213..230
AAA_2 [PF07724], Evalue: 1.70E-40, Aligned region: 587..754
AAA [PF00004], Evalue: 5.20E-20, Aligned region: 212..325
AAA [PF00004], Evalue: 5.20E-20, Aligned region: 592..710
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 189..234
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 255..290
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 466..511
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 560..615
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 656..684
AAA_16 [PF13191], Evalue: 6.40E-13, Aligned region: 714..743
AAA_5 [PF07728], Evalue: 1.50E-11, Aligned region: 212..234
AAA_5 [PF07728], Evalue: 1.50E-11, Aligned region: 591..714
ClpB_D2-small [PF10431], Evalue: 5.50E-11, Aligned region: 541..559
ClpB_D2-small [PF10431], Evalue: 5.50E-11, Aligned region: 759..833
AAA_22 [PF13401], Evalue: 8.80E-09, Aligned region: 211..293
AAA_22 [PF13401], Evalue: 8.80E-09, Aligned region: 588..629
Sigma54_activat [PF00158], Evalue: 2.70E-07, Aligned region: 209..228
Sigma54_activat [PF00158], Evalue: 2.70E-07, Aligned region: 572..710
IstB_IS21 [PF01695], Evalue: 2.40E-06, Aligned region: 206..234
IstB_IS21 [PF01695], Evalue: 2.40E-06, Aligned region: 591..621
IstB_IS21 [PF01695], Evalue: 2.40E-06, Aligned region: 701..725
Arch_ATPase [PF01637], Evalue: 3.00E-06, Aligned region: 191..226
Arch_ATPase [PF01637], Evalue: 3.00E-06, Aligned region: 264..361
Arch_ATPase [PF01637], Evalue: 3.00E-06, Aligned region: 584..630
Arch_ATPase [PF01637], Evalue: 3.00E-06, Aligned region: 763..817
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 212..327
AAA_14 [PF13173], Evalue: 1.70E-05, Aligned region: 589..685
AAA_25 [PF13481], Evalue: 3.10E-05, Aligned region: 212..283
AAA_25 [PF13481], Evalue: 3.10E-05, Aligned region: 587..612
AAA_25 [PF13481], Evalue: 3.10E-05, Aligned region: 654..675
NACHT [PF05729], Evalue: 5.20E-05, Aligned region: 212..239
NACHT [PF05729], Evalue: 5.20E-05, Aligned region: 592..612
AAA_19 [PF13245], Evalue: 7.70E-05, Aligned region: 212..233
AAA_19 [PF13245], Evalue: 7.70E-05, Aligned region: 587..616
Zeta_toxin [PF06414], Evalue: 8.90E-05, Aligned region: 212..235
Zeta_toxin [PF06414], Evalue: 8.90E-05, Aligned region: 582..632
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 212..248
AAA_17 [PF13207], Evalue: 0.001, Aligned region: 591..629
RNA_helicase [PF00910], Evalue: 0.0016, Aligned region: 213..233
RNA_helicase [PF00910], Evalue: 0.0016, Aligned region: 482..523
RNA_helicase [PF00910], Evalue: 0.0016, Aligned region: 592..615
RNA_helicase [PF00910], Evalue: 0.0016, Aligned region: 692..709
AAA_29 [PF13555], Evalue: 0.0028, Aligned region: 204..228
AAA_29 [PF13555], Evalue: 0.0028, Aligned region: 586..602
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 207..231
DUF258 [PF03193], Evalue: 0.0037, Aligned region: 578..602
AAA_18 [PF13238], Evalue: 0.0039, Aligned region: 132..157
AAA_18 [PF13238], Evalue: 0.0039, Aligned region: 212..235
AAA_18 [PF13238], Evalue: 0.0039, Aligned region: 592..620
AAA_23 [PF13476], Evalue: 0.0055, Aligned region: 212..229
AAA_23 [PF13476], Evalue: 0.0055, Aligned region: 428..510
AAA_23 [PF13476], Evalue: 0.0055, Aligned region: 588..781
ABC_tran [PF00005], Evalue: 0.0071, Aligned region: 213..230
ABC_tran [PF00005], Evalue: 0.0071, Aligned region: 471..502
ABC_tran [PF00005], Evalue: 0.0071, Aligned region: 585..629
RuvB_N [PF05496], Evalue: 0.0076, Aligned region: 212..229
RuvB_N [PF05496], Evalue: 0.0076, Aligned region: 282..292
RuvB_N [PF05496], Evalue: 0.0076, Aligned region: 552..612
RuvB_N [PF05496], Evalue: 0.0076, Aligned region: 659..685
NTPase_1 [PF03266], Evalue: 0.0081, Aligned region: 212..234
NTPase_1 [PF03266], Evalue: 0.0081, Aligned region: 591..618
Protein Sequence: 854 a.a.     [Download]
>gi|320158747|ref|YP_004191125.1| ClpB protein [Vibrio vulnificus MO6-24/O]
MASLSLSALVDKLTPEAKRALEQAAALASSRTHHSIEMTHWLLTLVQSAGPDEIELYRSFKVDLNQLQTD
FTLQLEKYKTGCQTVPGLSSHTVTILQNAWMTATIAFEAEKIAAVHLLHAFLSDDTLFALSSTVSKELSK
IQPSALIEYAQTHVEMANQIPNHRASTQALDQFTIDLTEQAELGQIDPVIGRDDEIRLMTDILLRRRQNN
PILTGEAGVGKTAVVEGLALKIAQGDVPPALKAVRIKSLDLALLQAGAGMKGEFENRLKNVVKEVKESAV
PIVLFIDEAHGLIGGGAQAGQGDAANILKPALARGELRTIAATTWAEYKKYVEKDAALTRRFQVVKIEEP
SPELAIEMLRGLVPVMEKHHGVHITTEALKAAVFLSSRYISGRQLPDKAVSVLDTACSRVALSQNSIPGL
LDQKYKKRQMIEAQQLQLTNELAFGHSHQTALDELESKLSLLQNEIHQLETTWRDEEGAVKQAKALRDSI
LAEPSAEKANQLQSIEQQLSSNPMPLVFSHVNEALIAEIIAGWTGIPLGKLKSDEIKAILDLQQHLQERV
VGQDHALSKMAEVIKTARAQLNEESKPNGIFFLVGPSGVGKTESALAIAEQVYGSEENITVINMSEFKEE
HKVSLLLGSPPGYVGYGEGGVLTEAVRRKPYSVILLDEMEKAHPGVQDIFYQVFDKGMIKDGEGRDIDFK
NTIIIMTSNSGTETTMELFQDPELAPDPEALKEALRDDLLQEFKPAFLGRVNVIPYIPLHRDVLEKITAL
KLSKIQKRIKTNYKAEAVINDRLINSIVDSCNETGSGARALQNVIENKVLPKISESVLNAILNDIRINKI
EIEGEVDDLSISIV
 
Nucleotide Sequence: 2565 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1066399-1063835 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGGCATCTCTTTCACTATCCGCGTTAGTTGACAAGTTAACCCCTGAAGCGAAAAGAGCATTAGAGCAAG
CCGCTGCTTTGGCGAGCTCAAGAACCCACCACAGTATTGAAATGACACATTGGCTGCTTACGCTAGTGCA
AAGTGCTGGGCCTGATGAAATCGAACTGTATCGTTCGTTTAAGGTTGATCTGAACCAACTGCAGACAGAT
TTCACTTTGCAATTAGAGAAGTACAAAACGGGCTGCCAAACTGTACCGGGGTTGTCATCCCATACGGTCA
CCATACTACAGAATGCGTGGATGACAGCGACGATCGCGTTCGAAGCAGAAAAAATTGCCGCTGTTCATTT
GCTTCATGCCTTCCTCTCTGACGACACGTTGTTTGCTCTATCTTCGACTGTGAGCAAAGAGCTAAGCAAA
ATTCAGCCTAGTGCGCTAATCGAATACGCACAGACTCATGTTGAAATGGCAAATCAAATTCCCAACCACA
GAGCTTCTACACAAGCGTTGGATCAATTTACGATAGATCTGACAGAGCAAGCAGAGCTGGGGCAAATTGA
TCCGGTGATTGGTCGCGATGATGAAATTCGGCTGATGACGGATATTCTTCTGCGACGCCGTCAAAATAAC
CCTATCCTGACGGGTGAGGCGGGGGTCGGTAAAACCGCCGTTGTCGAAGGACTTGCGCTAAAAATCGCTC
AAGGGGATGTGCCTCCCGCGCTTAAAGCAGTGAGAATTAAATCACTTGATTTGGCGCTACTCCAGGCCGG
TGCTGGTATGAAGGGCGAGTTTGAAAATCGGTTGAAGAACGTGGTCAAAGAAGTCAAAGAGTCTGCGGTA
CCTATCGTACTGTTTATCGATGAAGCGCATGGATTGATTGGTGGAGGGGCGCAGGCTGGTCAAGGTGATG
CTGCGAACATACTTAAGCCCGCCTTAGCCAGGGGGGAGCTACGCACGATCGCCGCAACCACATGGGCTGA
ATACAAAAAATATGTAGAGAAAGACGCAGCTCTGACCCGTCGTTTTCAAGTGGTTAAAATAGAGGAACCT
TCACCTGAATTGGCGATAGAGATGCTGCGTGGCCTCGTTCCTGTCATGGAAAAACATCATGGCGTCCACA
TTACTACCGAGGCACTCAAGGCTGCCGTCTTTCTTTCTTCTCGCTACATTAGCGGCCGTCAGTTGCCAGA
CAAGGCGGTATCGGTTTTAGATACCGCGTGCTCTCGTGTTGCTTTGAGTCAAAACTCGATACCAGGGCTG
CTTGATCAGAAATACAAAAAACGCCAAATGATAGAAGCTCAACAGCTTCAGCTCACCAATGAACTTGCAT
TTGGTCATTCTCATCAAACAGCTCTTGACGAACTTGAGAGCAAGTTGTCGCTCCTTCAAAATGAAATTCA
CCAACTAGAGACAACGTGGCGAGATGAAGAAGGCGCAGTCAAGCAGGCCAAAGCGCTCCGTGATTCCATT
TTGGCAGAACCATCTGCAGAGAAAGCCAATCAGCTGCAATCCATTGAACAGCAGTTATCGTCTAACCCGA
TGCCTTTGGTGTTTTCGCATGTTAACGAAGCCCTAATCGCTGAAATTATTGCAGGCTGGACAGGCATACC
ATTAGGCAAACTAAAAAGCGATGAAATAAAAGCGATTCTAGACTTACAGCAACATCTGCAAGAGCGAGTG
GTCGGCCAAGATCACGCGTTGAGTAAAATGGCGGAAGTGATCAAAACCGCGAGAGCACAGCTCAATGAAG
AATCAAAACCTAACGGTATCTTTTTCTTGGTAGGCCCAAGTGGTGTCGGTAAAACGGAATCTGCGTTGGC
CATTGCTGAGCAAGTGTATGGTAGTGAAGAAAACATCACCGTCATTAACATGTCTGAATTTAAAGAAGAG
CATAAAGTCTCGTTACTGCTGGGCTCTCCTCCGGGCTACGTTGGGTATGGCGAAGGTGGTGTGCTAACGG
AAGCCGTAAGAAGAAAACCTTACAGCGTCATATTGCTTGATGAAATGGAGAAAGCCCATCCGGGTGTACA
GGATATTTTCTATCAAGTGTTTGATAAGGGCATGATTAAAGACGGTGAAGGGCGAGACATCGATTTCAAA
AACACCATCATTATCATGACTTCCAACTCTGGGACGGAAACAACAATGGAGTTATTCCAAGATCCAGAGC
TTGCTCCGGATCCGGAGGCACTCAAAGAAGCGCTACGAGATGATTTATTACAGGAATTCAAGCCCGCTTT
TTTAGGTCGAGTGAATGTCATTCCTTATATCCCTTTGCACCGTGATGTATTGGAGAAAATCACCGCGCTG
AAACTCTCCAAAATTCAGAAGAGGATAAAAACAAACTATAAAGCAGAAGCGGTGATCAACGATCGCTTAA
TTAATAGTATTGTTGACAGCTGCAATGAAACGGGCAGTGGCGCGCGTGCTCTTCAAAATGTGATTGAAAA
TAAGGTGCTGCCTAAAATATCTGAATCCGTATTAAATGCCATTCTTAATGATATAAGAATAAATAAAATT
GAGATAGAAGGTGAAGTTGATGACTTGTCTATCTCAATCGTCTAA
 Primer design