SecReT6
Protein ID: 320158748
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03901
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1066413..1067414 [-]
Producthypothetical protein
NoteTssG
UniProt IDE8VUQ8
KEGG IDvvm:VVMO6_03901
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.90E-69, Aligned region: 19..319
Protein Sequence: 333 a.a.     [Download]
>gi|320158748|ref|YP_004191126.1| hypothetical protein VVMO6_03901 [Vibrio vulnificus MO6-24/O]
MAIDGGRERAVMKSEDFLAEIESLPLFTAIHLIETHLLQADSHLGSDALPKNEKIQLTVSQRLGYEAREL
INVVSNSQSNKLTLQTNIIGLTGEQGVLPSHYSELVMQRARENDTAMKDFFDIFNHRLLSLYYRCWQSYQ
LPAQLRTQDKKSASSPIQIVLSSLTGNLDDEAIFFGGMFTSKRRSRAYIKSVIEFYTGCDVRLHEFKGRW
FDISEAEQTRLCSRDRPEGQHAQLGLGAMLGKQSWNMSSGFDVELIAKDPDSLAALLHTERLGETKLLMC
RMLGTSKRIRWTLTARRAQLPSANLAKGRGRLGKGSILMPSLSNANKQITITI
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1067414-1066413 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGGCCATCGATGGCGGGAGAGAGAGAGCTGTTATGAAAAGTGAAGATTTTCTCGCTGAGATTGAATCGC
TACCTCTCTTTACCGCGATACATTTGATCGAGACTCATCTACTGCAGGCAGATAGTCATCTGGGTTCTGA
TGCGTTACCAAAGAATGAAAAAATCCAGCTCACAGTCTCGCAACGTTTAGGTTATGAGGCGCGAGAGCTG
ATAAATGTCGTGTCAAATAGCCAGAGCAATAAATTAACCTTACAAACCAACATCATCGGTTTAACCGGTG
AGCAGGGGGTACTGCCGAGTCATTACAGCGAGCTGGTTATGCAAAGGGCGCGTGAAAATGACACGGCTAT
GAAGGATTTCTTCGACATTTTTAACCACAGACTGCTCTCTCTCTACTACCGGTGTTGGCAGTCATACCAA
TTGCCCGCACAACTGCGAACGCAAGATAAGAAATCTGCCTCGTCGCCAATTCAGATCGTCCTCTCCTCTC
TGACTGGCAACCTTGACGATGAAGCGATTTTCTTTGGCGGTATGTTTACGTCAAAGCGTCGAAGCCGTGC
ATACATCAAAAGCGTCATTGAGTTTTATACCGGATGTGATGTGCGTTTGCATGAGTTCAAAGGTCGCTGG
TTTGACATTAGTGAAGCAGAGCAAACTCGCCTTTGCAGCCGTGATAGGCCGGAAGGGCAGCACGCACAAC
TGGGATTGGGGGCCATGCTTGGTAAGCAAAGCTGGAACATGAGTTCTGGATTTGATGTCGAGTTGATTGC
AAAGGACCCTGATTCATTGGCGGCGTTGCTCCACACCGAACGATTGGGTGAGACCAAGCTTTTGATGTGC
CGCATGTTGGGGACGAGTAAGCGTATTCGTTGGACTTTAACCGCTCGTAGAGCACAACTTCCTAGCGCTA
ACTTAGCAAAAGGAAGAGGTCGATTAGGCAAAGGCAGTATCTTAATGCCGAGCCTATCGAACGCAAATAA
ACAAATAACGATAACAATTTAA
 Primer design