SecReT6
Protein ID: 320158749
SecReT6 ID421
T6SS typei5
Gene symbol-
Locus tagVVMO6_03902
StrainVibrio vulnificus MO6-24/O
Repliconchromosome II [GenBank: NC_014966] [Browse all T6SS(s) in this replicon]
Location [Strand]1067378..1069204 [-]
Productprotein ImpG/VasA
NoteTssF
UniProt IDE8VUQ9
KEGG IDvvm:VVMO6_03902
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.80E-187, Aligned region: 5..608
Protein Sequence: 608 a.a.     [Download]
>gi|320158749|ref|YP_004191127.1| protein ImpG/VasA [Vibrio vulnificus MO6-24/O]
MSEDFLKYYNRELAYLRHKGHEFGEQYPKIAARLRMNDEVVEDPHVSRLLEGCAFLSARIRQSLDNAFPQ
LTEALIGQLFPDFHAPIPSMSIVQLKGTTSSSSAFTVAKGERVTITAPGYQECDFKTCCATQVHPFDVTD
AQFENAPFSGTECRMELAAKSVLKLEIQSNNAELSLSTLDDSCLRFYLSGQRQAALQLYQQIFQSCIGLS
LVQGGRCKKELTPRHIRSLGFDDQIQAVPYSKRSFSGTRLLIEYLHFPEKFLFFELTDLDLSVLASEQGK
AEIWLYFAEGNDWLEKQVSVENIALGAVPVVNLYQAKMKPMRVQASEYEYQLHPEHCDPESSEVVSIDDV
TLRNWNKVFENLPPYYAGTHTHYQTQYDLFWLMRREDRNWAGGFDEPGREVFVSLVDRKHQLFAPDAKES
WLMSIDTWCCNRNLPAKIPFGGGLPLVTLPESQDNFSRVRCLTTPTETIRAEMDETTRWQFAKLITLDHF
CNQQGAETLKQILNLLAFRGSPETKALIDSIKGMSTKMTTGRVVQNGRVGFCHGSEITLTISDQILSREQ
IFLLGNVLSSYFSQFAEVNTFTRLLIKLSSTGALFHTWPSMAGERELL
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|320157827|ref|NC_014966.1|:c1069204-1067378 Vibrio vulnificus MO6-24/O chromosome II, complete sequence
ATGAGTGAAGATTTTCTGAAATACTACAATCGAGAACTCGCGTATTTGCGTCATAAAGGCCATGAATTTG
GGGAACAATACCCTAAGATTGCCGCTCGATTGCGAATGAATGATGAAGTCGTTGAAGACCCTCATGTCTC
AAGGCTTCTCGAAGGGTGTGCTTTTCTCTCTGCTCGTATACGACAAAGCTTGGATAACGCGTTTCCACAG
CTAACCGAAGCGTTAATTGGGCAGCTATTTCCCGATTTTCACGCCCCCATTCCGTCAATGTCGATTGTGC
AGTTGAAAGGAACGACTTCTTCGTCGTCGGCGTTTACGGTGGCCAAAGGAGAACGTGTCACGATCACGGC
ACCGGGATACCAAGAGTGTGACTTCAAAACATGCTGTGCCACACAAGTTCATCCTTTTGATGTCACTGAC
GCCCAGTTTGAAAATGCCCCTTTTAGTGGCACAGAATGTCGTATGGAGCTCGCTGCCAAGTCAGTGCTCA
AACTCGAAATTCAATCGAACAATGCTGAGTTGAGCCTATCCACTCTGGATGATTCATGCCTGCGATTCTA
TCTGAGTGGTCAACGACAAGCCGCTCTGCAGCTTTATCAACAAATTTTTCAATCCTGCATTGGCCTAAGC
TTGGTACAAGGAGGTCGATGCAAAAAAGAGCTCACGCCACGTCACATACGTTCATTGGGCTTCGACGACC
AAATACAAGCGGTTCCATACAGTAAGCGTAGCTTTTCTGGCACGCGTCTATTGATCGAGTACTTGCACTT
CCCCGAAAAATTTCTCTTTTTTGAGCTGACAGACTTAGATCTCTCAGTCCTCGCTAGCGAACAAGGGAAA
GCAGAAATCTGGCTCTATTTTGCAGAGGGCAACGACTGGTTGGAGAAACAAGTCTCTGTCGAAAATATCG
CCTTAGGAGCGGTTCCGGTTGTCAATCTTTATCAAGCGAAAATGAAGCCAATGAGGGTGCAAGCCTCTGA
ATATGAATATCAACTGCATCCAGAGCACTGCGATCCAGAGTCGAGTGAAGTGGTCAGTATTGATGACGTC
ACTTTAAGAAACTGGAATAAGGTCTTCGAAAACTTGCCCCCTTACTATGCGGGGACGCATACCCACTATC
AAACGCAATATGATCTGTTCTGGTTAATGCGTAGAGAAGATAGAAACTGGGCTGGGGGTTTTGATGAACC
CGGGCGGGAAGTGTTCGTATCACTGGTTGATCGTAAGCACCAATTGTTTGCCCCCGATGCGAAAGAAAGT
TGGTTGATGTCGATCGACACGTGGTGTTGCAATCGTAATCTCCCCGCCAAAATTCCGTTTGGTGGAGGGC
TTCCTTTGGTCACATTGCCCGAGAGTCAGGACAATTTTAGTCGCGTTCGTTGCTTGACCACGCCAACCGA
AACCATTCGCGCCGAAATGGATGAGACGACTCGATGGCAGTTTGCAAAACTGATTACATTGGATCATTTC
TGCAATCAACAAGGAGCGGAAACGCTTAAGCAAATCTTAAACTTGCTGGCTTTTAGAGGTTCGCCAGAAA
CCAAAGCATTGATCGATTCAATTAAAGGTATGTCGACAAAGATGACGACTGGGCGTGTGGTGCAAAATGG
TCGGGTCGGTTTTTGCCACGGCAGCGAAATCACCTTAACGATTTCCGATCAGATTTTGTCTCGAGAACAG
ATCTTTTTGTTAGGAAACGTGCTATCGAGTTACTTCTCACAATTCGCTGAAGTCAACACGTTCACACGGC
TACTGATTAAGCTCTCCTCCACTGGGGCGTTATTCCATACATGGCCATCGATGGCGGGAGAGAGAGAGCT
GTTATGA
 Primer design